SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008040 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008040
Domain Number 1 Region: 136-321
Classification Level Classification E-value
Superfamily DNA-glycosylase 5.81e-50
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000224
Further Details:      
 
Domain Number 2 Region: 12-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.37e-38
Family DNA repair glycosylase, N-terminal domain 0.000000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008040   Gene: ENSMMUG00000006117   Transcript: ENSMMUT00000008553
Sequence length 345
Comment pep:known chromosome:MMUL_1:2:51239487:51247402:-1 gene:ENSMMUG00000006117 transcript:ENSMMUT00000008553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARALLPRRMGHRTLASAPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLHCTVYRGDKSQPGRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG
FPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLPWLQQLREASYEEAHKAL
CTLPGVGTKVADCICLMALDKPQAVPVDVHIWQIAQRDYSWHPTTSQAKGPSPQSNKELG
NFFRSLWGPHAGWAQAVLFSADLHQSHRAQEPPAKRRKGSKGLEV
Download sequence
Identical sequences F7B0C2
NP_001247508.1.72884 ENSMMUP00000008040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]