SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008270 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008270
Domain Number 1 Region: 45-284
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.05e-66
Family Alanine racemase-like, N-terminal domain 0.0000000425
Further Details:      
 
Domain Number 2 Region: 249-439
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 4.01e-31
Family Eukaryotic ODC-like 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008270   Gene: ENSMMUG00000006285   Transcript: ENSMMUT00000008799
Sequence length 479
Comment pep:known chromosome:MMUL_1:1:35863498:35904122:1 gene:ENSMMUG00000006285 transcript:ENSMMUT00000008799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSESDFVMVEEGFSTRDLLKELTLGASEATTDEVAAFFVADLGAIVRKHFCFLKCL
PRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELVQHIGVPASKIIYANPCKQIAQ
IKYAAKHGIQLLSFDNEMELAKVVKSHPSAKMVLCIATDDSHSLSRLSLKFGVSLKSCRH
LLENAKKSHVEVVGVSFHIGSGCPDPQAYAQSIADVRLVFEMGTELGHKMHVLDLGGGFP
GTEGAKVRFEEIASVINSALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIIAKKEVLLD
QPGKEAPLPPPHIAICAADPSSPAEENGSTTKTVVYHLDEGVYGIFNSVLFDNICPTPIL
QKKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFGGT
QACHITYAMSRVAWEALRRQLMAAEQEDDAEGVCKPLSCGWEITDTLCVGPVFTPASIM
Download sequence
Identical sequences ENSMMUP00000008271 ENSMMUP00000008270 9544.ENSMMUP00000008270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]