SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008271 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008271
Domain Number 1 Region: 45-296
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.55e-64
Family Alanine racemase-like, N-terminal domain 0.0000000506
Further Details:      
 
Domain Number 2 Region: 261-359
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000000000000356
Family Eukaryotic ODC-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008271   Gene: ENSMMUG00000006285   Transcript: ENSMMUT00000008800
Sequence length 373
Comment pep:known chromosome:MMUL_1:1:35863498:35883925:1 gene:ENSMMUG00000006285 transcript:ENSMMUT00000008800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSESDFVMVEEGFSTRDLLKELTLGASEATTDEVAAFFVADLGAIVRKHFCFLKCL
PRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELVQHIGVPASKIIYANPCKQIAQ
IKYAAKHGIQLLSFDNEMELAKVVKSHPKARFVQQRGTACLIRMVLCIATDDSHSLSRLS
LKFGVSLKSCRHLLENAKKSHVEVVGVSFHIGSGCPDPQAYAQSIADVRLVFEMGTELGH
KMHVLDLGGGFPGTEGAKVRFEEIASVINSALDLYFPEGCGVDILAELGRYYVTSAFTVA
VSIIAKKEVLLDQPGKEEENGSTTKTVVYHLDEGVYGIFNSVLFDNICPTPILQKSKSHP
PCMSLEFIHFTAV
Download sequence
Identical sequences ENSMMUP00000008271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]