SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008272 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008272
Domain Number 1 Region: 2-189
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.06e-47
Family Alanine racemase-like, N-terminal domain 0.000000318
Further Details:      
 
Domain Number 2 Region: 154-325
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.51e-36
Family Eukaryotic ODC-like 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008272   Gene: ENSMMUG00000006285   Transcript: ENSMMUT00000008801
Sequence length 365
Comment pep:known chromosome:MMUL_1:1:35862376:35904459:1 gene:ENSMMUG00000006285 transcript:ENSMMUT00000008801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVQHIGVPASKIIYANPCKQIAQIKYAAKHGIQLLSFDNEMELAKVVKSHPSAKMVLC
IATDDSHSLSRLSLKFGVSLKSCRHLLENAKKSHVEVVGVSFHIGSGCPDPQAYAQSIAD
VRLVFEMGTELGHKMHVLDLGGGFPGTEGAKVRFEEIASVINSALDLYFPEGCGVDILAE
LGRYYVTSAFTVAVSIIAKKEVLLDQPGKEEENGSTTKTVVYHLDEGVYGIFNSVLFDNI
CPTPILQKKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMG
SPFGGTQACHITYAMSRVAWEALRRQLMAAEQEDDAEGVCKPLSCGWEITDTLCVGPVFT
PASIM
Download sequence
Identical sequences ENSMMUP00000008272 ENSMMUP00000040443 XP_011761611.1.29376 XP_011761612.1.29376 XP_014989884.1.72884 XP_014989885.1.72884 XP_014989889.1.72884 XP_014989893.1.72884 XP_015307737.1.63531 XP_015307740.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]