SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008273 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008273
Domain Number 1 Region: 94-189
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000000000000628
Family Eukaryotic ODC-like 0.00058
Further Details:      
 
Domain Number 2 Region: 41-93
Classification Level Classification E-value
Superfamily PLP-binding barrel 0.000000000028
Family Alanine racemase-like, N-terminal domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008273   Gene: ENSMMUG00000006285   Transcript: ENSMMUT00000008802
Sequence length 203
Comment pep:known chromosome:MMUL_1:1:35863498:35883925:1 gene:ENSMMUG00000006285 transcript:ENSMMUT00000008802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSESDFVMVEEGFSTRDLLKELTLGASEATTDEVAAFFVADLGAIVRKHFCFLKCL
PRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKIASVINSALDLYFPEGCGVDILAELGR
YYVTSAFTVAVSIIAKKEVLLDQPGKEEENGSTTKTVVYHLDEGVYGIFNSVLFDNICPT
PILQKSKSHPPCMSLEFIHFTAV
Download sequence
Identical sequences A0A2K5V2D3
ENSMMUP00000008273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]