SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008356 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008356
Domain Number 1 Region: 231-337
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000986
Further Details:      
 
Domain Number 2 Region: 366-467
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000672
Further Details:      
 
Domain Number 3 Region: 21-127
Classification Level Classification E-value
Superfamily SRCR-like 9.42e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0011
Further Details:      
 
Domain Number 4 Region: 129-231
Classification Level Classification E-value
Superfamily SRCR-like 5.62e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008356   Gene: ENSMMUG00000006334   Transcript: ENSMMUT00000008887
Sequence length 468
Comment pep:novel chromosome:MMUL_1:9:133082596:133094999:1 gene:ENSMMUG00000006334 transcript:ENSMMUT00000008887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTASHVLGLPCASHADSSSPPEFRLVNGSSSCEGRVELQVQGSWAPLCATHWDIADATV
LCHQLNCGNAVAAPRGGHFGDGDAAIWPDAFHCGGTEPYLWNCPVSTLGAPACAPGNSAS
AVCSGLPHAVRLREGQSRCDGRVEVSLEGVWGRVLDDAWDLRGADVVCRQLGCGAAEQAY
DAPAPSRGSVQVSLSRARCLGTETRLTQCNVSATLQEPAGTSRDAGVVCSGSLGVRLAAG
PGRCAGRVEVLHGGAWGTVCDDAWDLQDAHVVCRQLGCGRALSALGAAHFGAGAGRIWLD
ELGCQGHESALWQCPSAGWGQHDCRHKEDAGVLCSAGASWSSPAWAHFPPSPAQVSLKFP
SGIHEGALRVRGGEDRCSGRVELWHAGSWGTVCDDGWDLADAEVVCRQLGCGGAVAALGA
AAFGPGSGPVWLDEVGCRGSEASLRGCPAERWGRGDCAHKEDAGVRCL
Download sequence
Identical sequences ENSMMUP00000008356 9544.ENSMMUP00000008356 ENSMMUP00000008356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]