SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008375 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008375
Domain Number 1 Region: 1572-1727
Classification Level Classification E-value
Superfamily FAS1 domain 1.96e-29
Family FAS1 domain 0.0013
Further Details:      
 
Domain Number 2 Region: 979-1130
Classification Level Classification E-value
Superfamily FAS1 domain 9.29e-27
Family FAS1 domain 0.0015
Further Details:      
 
Domain Number 3 Region: 525-655
Classification Level Classification E-value
Superfamily FAS1 domain 1.96e-24
Family FAS1 domain 0.0016
Further Details:      
 
Domain Number 4 Region: 1145-1266
Classification Level Classification E-value
Superfamily FAS1 domain 4.58e-23
Family FAS1 domain 0.0029
Further Details:      
 
Domain Number 5 Region: 1741-1882
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-20
Family FAS1 domain 0.0037
Further Details:      
 
Domain Number 6 Region: 338-504
Classification Level Classification E-value
Superfamily FAS1 domain 1.44e-19
Family FAS1 domain 0.0047
Further Details:      
 
Domain Number 7 Region: 2139-2191,2334-2443
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000000000262
Family FAS1 domain 0.0083
Further Details:      
 
Domain Number 8 Region: 2186-2262
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000565
Family Link domain 0.0051
Further Details:      
 
Domain Number 9 Region: 1474-1513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000144
Family EGF-type module 0.072
Further Details:      
 
Domain Number 10 Region: 1516-1554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000921
Family Merozoite surface protein 1 (MSP-1) 0.086
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000008375
Domain Number - Region: 234-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000181
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 2083-2120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000921
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 915-995,1341-1389
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00392
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 198-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00487
Family Merozoite surface protein 1 (MSP-1) 0.033
Further Details:      
 
Domain Number - Region: 740-779
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00514
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 878-918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family EGF-like domain of nidogen-1 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008375   Gene: ENSMMUG00000006347   Transcript: ENSMMUT00000008906
Sequence length 2545
Comment pep:known_by_projection chromosome:MMUL_1:11:104712841:104881310:1 gene:ENSMMUG00000006347 transcript:ENSMMUT00000008906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMLQHLVIFCLGLVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTK
ITNGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPRCCPGHWGPDCIECPGGAESPC
NGRGSCAEGMEGNGTCSCQEGFGGTACETCANDNLFGPSCSAVCNCVHGVCNSGLDGDGT
CECYSAYTGPKCDKPIPQCAALLCPENSRCSPSTEDENKLECKCLPNYQGDGKYCEPINP
CLQKICHPRAHCTYLGPNRHSCTCQEGYRGDGRVCLPVDPCQTNFGNCPTKSTVCKYDGP
GQSHCECKKHYHNFVPGMGCSMINICKTNNLCHRNANCTTVGPGQTQCMCRKGYVGDGLT
CYGNIMERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDEGLKEFNV
NELLVDNKAAQYFVKLHIIAGQMNIEYMNNTDTFYTLTGKSGEIFNSDKDNQIKLKLYGG
KNKVKIIQGDIIASNGLLHILDRTMDMLEPIFESNNEQTIMTMLQPRYSKFRSLLEKTNV
GHALDEDGVGGPYTIFVPSNEALNNMKDGTLDYLLSPEGSRKLLELVRYHIVPFTQLEVA
TLISTPHIRSMANQLIQFTTTDNGQILANDVAMEEIEITAKNGRIYTLTGVLIPPSIVPI
LPHRCDETKREMKLGTCVSCSLVYWSRCPANSEPTVKLTTRRCCQPGNVRGRRGNCVGWC
HSDCCIPKCCKGFYGPDCNQCPGGFSNPCSGNGQCAESLAGNGTCICKEGFQGSQCQFCS
DPNKYGPQCNQKCPCVHGTCDNRIDSDGACLTGTCRDGSAGRLCDKQTSACGPYVQFCHI
HATCEYSSGTASCVCKAGYEGDGTVCSEMDPCTGLTPGGCSRNAECIKTGTGTHTCVCQQ
GWTGNGRDCLEINNCLLPSAGGCHDNATCLYVGPGQNECECKKGFRGNGIDCEPVTSCLE
QTRKCHPLANCQSTSSGVWSCVCQEGYEGDGFLCYGNAAVELSFLSEAAIFNQWINNASL
QLTLSATSNLTVLVPSQQATKDMDQDEKSFWLSQSNIPALIKYHILLGTYRVADLQTLSS
SDMLATSLQGNFLHLAKVDGNITIEGASIVDGDNAATNGVIHIINKVLVPQRRLTGSLPN
LLMRLEQMPDYSIFRGYIQQYNLANAIEAADAYTVFAPNNDAIANYIREKKVPSLKEDVL
RYHVVLEEKLLKNDLHNGMHRKTMLGFSYFLGFFRHNNQLYVNEAPINYTNVATDKGVIH
GLGKVLEIQKNRCDNNDTTIIRGRCRTCSSELICPFGTRPLSNEKRRCIYTSYFMGRRTL
FIGCQLKCVRTVITRECCAGFFGPQCLPCPGNAQNVCFGNGICLDGVNGTGVCECEEGFS
GTACETCTEGKYGTHCDQACSCVHGRCNQGPLGDGSCDCDVGWRGVHCENVTTEDNCNGM
CHTSANCLPNSDGTASCKCLHGLLKDSCSCTINACEISNGGCSAKADCKRTTPGRRVCTC
KAGYMGDGIVCLEINPCLENHGGCDKNAECTQTGPNQAACNCLPAYTGDGKVCTLINVCL
TKNGGCSEFAICNHTGQGERTCTCKPNYVGDGFTCRGNIYQELPKNPKTSQYFFQLQEHF
VKDLVGPGPFTVFAPLSAAFDEEARVKDWDKQGLMPQVLRYHVVACHQLLLEHLILISNA
TSLQGEPIVISVSQGTVYINNKAKIISSDIISTNGIVHIIDKLLSPKNLLITPKDTSGRI
LQNLTTLATKNGYIKFSNLIQDSGLLSVITDPIHTPVTLFWPTDRALQALPAEQQDFLFN
QDNKDKLKEYLKFHVIRDAKVLAVDLPTSTAWKTLQGSELSVKCGAGSDIGDLFLKGQTC
RIVQRELLFELGVASGIDCLLIDPTLGGRCDTFTAFPCRGSCGSCVNTPSCPRWSKPKGE
KQKCLYNLPFKRNLEGCREWCSLVIQIPRCCKGYFGRDCQACPGGPDAPCNNRGVCLDQY
TGTGMCKCNTGFNGTACEMCWPGRFGPNCLRMGTYEHSGRPDRVLGSLLRWVLTLHTMVA
PFFAVLPAVCTPPCSPHATCKENNTCECNLDYEGDGITCTVVFCKQDNGGCAKVARCSQK
GTKVSCSCQKGYKGDGLSCTEIDPCADGLNGGCHEHATCKMTGPGKHKCECKSHYVGDGL
NCEPEQLPIDRCLQDNGQCHADAKCVDLHFQDTTVGVFHLRSPLGQYKLTFDKAKEACAN
ETATMATYSQLSYAQKVGRQLADSGWKLPGSNLSPSCFREERAPSMSIGLVHGEVRPRTP
KWSLCPQTKDTHLTGKVLKLSRCRQKTQQRSSRLSLLTHEYSQMVLAYSNSSARGRAFLE
HLTDLSIRGTLFVPQNSGLGENETLSGRDIEHHLANVSMFFYNDLVNGTTLQTRLGSKLL
ITASHDPLQPTETRFVDGRAILQWDIFASNGIIHIISRPLKAPPAPMSLTHTGLGAGIFF
AVILVIGAVALAAYSFFRLNRRTIGFQHFESEEDINVAAVGKQQPENISNPLYESATSAP
PEPSYDPFTDSDERQLEGNDPLGTL
Download sequence
Identical sequences ENSMMUP00000008375 ENSMMUP00000008375 9544.ENSMMUP00000008375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]