SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008421 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008421
Domain Number 1 Region: 23-141
Classification Level Classification E-value
Superfamily Immunoglobulin 1.48e-21
Family V set domains (antibody variable domain-like) 0.00018
Further Details:      
 
Domain Number 2 Region: 366-443
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000236
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 143-232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000435
Family C1 set domains (antibody constant domain-like) 0.071
Further Details:      
 
Domain Number 4 Region: 255-344
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000556
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008421   Gene: ENSMMUG00000006385   Transcript: ENSMMUT00000008956
Sequence length 590
Comment pep:known_by_projection chromosome:MMUL_1:19:56223024:56235929:-1 gene:ENSMMUG00000006385 transcript:ENSMMUT00000008956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLPLLLPVLGAGSLNKDPSYSLQVQKQVTVQEGLCIMVPCNLSYPWDGWNESTAAYGY
WFKEGTNTNTGAPVATNNPSREVEMSARGRFQLTGDPGKGSCSLVIRDAQREDEARYFFR
VERGTHVRYNFRNNGFLLQVTALTQKPDVYIPETLEPGQPVTVICVFNWASEECPAPSFS
WTGTALSSQGTKPTTSHFSVISFTPSPQDHDTDLTCHVDFSRKGVSAQRTVRLRVAYAPR
DLVISISRDNTSALKPQENLTHLEARKGQFLRLLCAADSQPPATLSWVLQDRVLSLSHPW
GPRTLGLELPGVKAGDSGRYTCRAENRLGSQQRALDLSVQYPPENLRVMVSQANRTVLEN
LGNGTSLPVLEGQSLRLVCVTHSSPPARLSWTQGGQTVGSSQPSDPGVLELPRVQVEQEG
EFTCHAQHPLGSQHISLSLTVHRKLQRGGGVGLGTALGAGVTALLALCSCLVIFGVKTCR
KEARKRAAAEQDVPSTLGPISQGQQHECSAGSSQDHLPPGAATPTPGQGEEQEVYYASLS
FQGMRLREPEDQEAPSSTEYSEIKIHKGQPPRGLGSGLQLEKETLGMVPK
Download sequence
Identical sequences ENSMMUP00000008421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]