SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008445 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008445
Domain Number 1 Region: 186-439
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.66e-57
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 7-112
Classification Level Classification E-value
Superfamily POZ domain 3.4e-33
Family Tetramerization domain of potassium channels 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008445   Gene: ENSMMUG00000006403   Transcript: ENSMMUT00000008981
Sequence length 511
Comment pep:known chromosome:MMUL_1:14:54162552:54200457:-1 gene:ENSMMUG00000006403 transcript:ENSMMUT00000008981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRH
PGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALD
SFGGAPLDNSADDADAEGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALF
EDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAE
TEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSS
KAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFA
TMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALC
ALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPH
HSTQSDTCPLAQEEILEINRAGRKPLRGMSI
Download sequence
Identical sequences ENSMMUP00000008445 9544.ENSMMUP00000008445 ENSMMUP00000008445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]