SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008446 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008446
Domain Number 1 Region: 222-387,419-481
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-37
Family Voltage-gated potassium channels 0.0036
Further Details:      
 
Domain Number 2 Region: 484-677
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-31
Family cAMP-binding domain 0.00062
Further Details:      
 
Domain Number 3 Region: 40-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.84e-25
Family Flavin-binding PAS domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008446   Gene: ENSMMUG00000006401   Transcript: ENSMMUT00000008983
Sequence length 1013
Comment pep:known_by_projection chromosome:MMUL_1:16:52268118:52289864:-1 gene:ENSMMUG00000006401 transcript:ENSMMUT00000008983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQGPRGFPIVYCSDGFCELTGYGRTEV
MQKTCSCRFLYGPETSEPALQRLHKALEGHQEHRTEICFYRKDGSAFWCLLDMMPIKNEM
GEVVLFLFSFKDITQSGSPGLGPQGGRRDSNHENSLGRRGATWKFRSARRRSRTVLHRLT
GHFGRRGQGGMKANNNVFEPKPSVPEYKVASVGGSRCLLLHYSVPKAIWDGLILLATFYV
AVTVPYNVCFSGDDDTPITSRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVISAPRSI
GLHYLATWFFVDLIAALPFDLLYVFNITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAV
VLTLLMSVFALLAHWMACIWYVIGRREMEANDPLLWDIGWLHELGKRLEVPYVNGSVGGP
SRRSAYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQR
MYSRRSLYHSRMKDLKDFISVHRLPRPLKQRMLEYFQTTWAVNSGIDANELLRDFPDELR
ADIAMHLNREILQLPLFGAASRGCLRALSLHIKTSFCAPGEYLLRRGDALQAHYYVCSGS
LEVLRDNMVLAILGKGDLIGADIPEPGQEAGLGADPSFVLKTSADVKALTYCGLQQLSSQ
GLAEVLRLYPEYGAAFRAGLPRDLTFNLRQGSDTSSPFLQSRPPQPEKSLGSSSDKTLPS
ITEAESGTEPGGGPRPRRPLLLPNLSPARPRGSLVSLLGEELPPFSALVSSPSLSPSLSP
ALAGQGHSASPHSPPRCSAAWKPPQLLIPPLGTFGPPDLSPRIVDGIEDSGSTAEAPSFR
FSRRPEPPRPRSQVPPTGTRPSPELASEAEEVKEKVCRLNQEISRLNQEVSQLSRELRHI
MALLQARLGPPGHPAGSAWTPDPPCPQLRPPGLSPCASRPSPSLQDTTLAEVHCPASVGT
METGTAPLDLRPSILPPYPSEPDPLGPSPVPEASPPTPSLMRHSFQSRSDTFH
Download sequence
Identical sequences ENSMMUP00000008446 ENSMMUP00000008446 9544.ENSMMUP00000008446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]