SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008683 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008683
Domain Number 1 Region: 22-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 8.51e-84
Family Carbonic anhydrase 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008683   Gene: ENSMMUG00000019687   Transcript: ENSMMUT00000009241
Sequence length 308
Comment pep:known_by_projection chromosome:MMUL_1:1:11992900:12025261:1 gene:ENSMMUG00000019687 transcript:ENSMMUT00000009241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALVPLLSLFLLGGQAQHGSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN
PALKGLKLTGYETQEGEFPMVNNGHTVQISLPSTMRMTAADGTVYIAQQMHFHWGGASSK
IRGSEHTVDGIRHVIEIHVVHYNSKYKSYETAQDAPDGLAVLAAFVEVKDYPENTYYSSF
ISHLANIKYPGQTTTLTGLDIRDMLPKNLQHYYSYDGSLTTPPCTENVHWFVLADFVKLS
RTQVWKLENSLLDHHNKTIQNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLRKIEEIL
EYLRRALN
Download sequence
Identical sequences A0A2K5U933 H9ZDB1
ENSMMUP00000008683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]