SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008714 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008714
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 2.22e-28
Family Nucleoplasmin-like core domain 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008714   Gene: ENSMMUG00000006631   Transcript: ENSMMUT00000009274
Sequence length 227
Comment pep:novel chromosome:MMUL_1:20:5535094:5535925:1 gene:ENSMMUG00000006631 transcript:ENSMMUT00000009274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYLFSCELKADKGYHFRVDNDEKEYQLSLRMVGLGAGAKDELHVVEAEAMNYEGSPVKVI
LATLANGGFEIMPPVILQLKCGSGTVHARGQHFVAMEEDAESQDEDKDVKPTRKQAAPGS
GSKVPQKKVKLAADEETEEKAPMKKSIMEKTQNHDQHQDQKDKNPSKNRKKPPKTPKGPS
SVEDVRAKMQGNIEKGGFLPKVEAKFINYVKNCFQMTDQEAIPDLWQ
Download sequence
Identical sequences ENSMMUP00000008714 ENSMMUP00000008714 9544.ENSMMUP00000008714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]