SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008726 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008726
Domain Number 1 Region: 1367-1526
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.86e-23
Family MHCK/EF2 kinase 0.078
Further Details:      
 
Domain Number 2 Region: 1305-1367
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000107
Family I set domains 0.069
Further Details:      
 
Domain Number 3 Region: 1597-1643
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000052
Family MHCK/EF2 kinase 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008726   Gene: ENSMMUG00000006635   Transcript: ENSMMUT00000009287
Sequence length 1677
Comment pep:known_by_projection chromosome:MMUL_1:18:51744926:51845935:-1 gene:ENSMMUG00000006635 transcript:ENSMMUT00000009287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDESVRETEMKPLSGESENSGMSQCWEMAAEKRVGGKDLRNERGSQKPARVRQLGMKGNP
KKPNANLRENTTEGTLHLCYAKESAKHPLTQSDKRETSHSTAAATGRNSHADAGECAIST
QAEQEAKTLQTSTDSLSKEGNTNCKGEGMQVNSLFETSQVPDWSDHPQVQIQETVRERIS
CSQMPAFSEPAGEESPFTGTTTISFSNLGGVHKENASLAQHLEVKPCTYDPQQEEKQDRD
GNTPDNFREDLKHELRTSEANDENTFPGVFSRHLPKDARADFREPVAVSVASPETTDTVL
TLENVCDGPRDREAVCAMECFEAGDQGTCFDTIDSLVGAPADKYLPQEICSVDLELAEGQ
RKVSDLCSPNGKTLEVLFQTQVSETSVSTYKSSKDGDSVMSPLFISTFTLNISHTASEGA
TEENLAKVENSTCPLASTVHAGQERSSPNKSGRLEETQLVSSENNPLVQFEEGGDKSPSP
SAADTTDTPARYSSIVSFPWEKTSTLTANNGFQVTRETEDTSTVTTATKVHPAKYLAVSI
PEDNHAGGTEERFPRASHEKVSQLPSQVQLGHILSGATTKSTKELLCTAPSVPGVPHHVL
QLPEGEDFFSNSPLQVDNLSGDKSQTVETADFRSHEENFQERGSEMKQGLQQQILSHQGS
LSAPDFQESLPMTSAAQEEINLVPSAHSPASSREGAGQRSVWGMRVSVVAETAGEEDSQA
LSNVPSLSDIILEESKEYRPGNREAGNKLKIITLEASASAIRPPRQRTNSESKASDGGPV
ISDKVWAVPDSLKADTVVPESAHSPEDADSALADSRESHKGEKPAISAHWRSLSSWGFSQ
PRLLESSVDPVDGKELCVTDSLSVASETGGKENVNNVSQDQEEKQLKMDHTAFFKKFLTC
SKILESSVDPIDETSVIEYTRAGKPEPSESTPEGAREGSQSNDGNVGHGAEIQPAILQVP
CLQGTILTENRISRSQEGSMKREAEQSQPDEAKTTIWQVLQPSEGCERIPSGCRIGQIQE
SSDGSLGEAEQSKKDKAELISPTSPLSSCLPIMTHASLGVDAHDSTGQIHDVPENDLVEP
RNRQYVFPVSQKRGTIENERGKPLPSSPHLTRLPCTSSPEGNVTNFLISHKMEEPKIEVL
QTGETKPPSSSSSSAKTLAFISGEDELEKAPKLLQDPHPKGTLHCVKKSREREKSLEAQA
GKSPGALTAVTGSEEVKRKPEAPGSGHLAEGVKKKILSKVAALRLKLEEKENARKNSAFL
KKVPKLKTSLSRTEEKQDPKKPSCKGEGRAPVLLKKIQAEMFPEHSGNVKLSCQFAEIHE
DSTICWTKDSKSIAQVQRSAGDNSTVSFAIVQASLKDQGLYYCCIKKNGLAAVLSDFCRA
TESIPSASVKEGPVGCEEIEFSQLIFKEDFLHDSYFGGRLRGQIATEELHFGEGVHRKAF
RSTVMHGLTPVFKPGHACVLKVHNAVAYGTRNNDELIQRNYKLAAQECYVQNTARYYAKI
YAAEAQPLEGFGEVPEQITPTFIYSLPKYLLAQATVHEQMLGTKISGRVFKAMHESARKG
NKGQGLVTVEHQTFQPSPQCQASADQSHRPVGLRKKDIIIITIARQYKGFKGNCSMTFID
QFKALHQCNKYCKMLGLKSLQNNSQKQKKPSTGKSKVQANSMTVKKTGSETPGEKKT
Download sequence
Identical sequences 9544.ENSMMUP00000008726 ENSMMUP00000008726 ENSMMUP00000008726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]