SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008753 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000008753
Domain Number - Region: 15-74
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0745
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008753   Gene: ENSMMUG00000006656   Transcript: ENSMMUT00000009316
Sequence length 78
Comment pep:known_by_projection chromosome:MMUL_1:14:12293174:12293978:1 gene:ENSMMUG00000006656 transcript:ENSMMUT00000009316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVAS
LFMGFGVLFLLLWVGIYV
Download sequence
Identical sequences A0A093GNT7 D2HUF4 G1SJE2 G3SYA9 G7ND08 G7PPX4 H0X3G1 H2PXP2 L5KR93 M7BV67 U6DUG8
ENSOCUP00000002850 ENSMMUP00000008753 ENSPPYP00000023536 ENSVPAP00000002153 ENSOGAP00000009659 ENSLAFP00000005456 10141.ENSCPOP00000012201 9544.ENSMMUP00000008753 9600.ENSPPYP00000023536 9986.ENSOCUP00000002850 ENSVPAP00000002153 ENSOGAP00000009659 ENSMMUP00000008753 ENSFCAP00000012692 ENSAMEP00000017627 ENSCPOP00000012201 ENSPPYP00000023536 ENSCPOP00000012201 ENSAMEP00000017627 ENSOCUP00000002850 ENSLAFP00000005456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]