SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008793 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008793
Domain Number 1 Region: 372-402
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000732
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008793   Gene: ENSMMUG00000006684   Transcript: ENSMMUT00000009358
Sequence length 410
Comment pep:known_by_projection chromosome:MMUL_1:X:103884168:103885941:-1 gene:ENSMMUG00000006684 transcript:ENSMMUT00000009358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRPEDPSSGFRHSNVVAFINEKMARHTKGPEFYLENISLSWEEVEDKLRAILEDSEVP
SEVKEACTWGSLALGVRFARRQAQLQRHRVRWLHGFAKLHKSAAQALASDLKELKAQQET
ERKEAASRLRMSQTSFVEVQKERDKELASPHEWEQGAGGPGLATAGGVCTEGAGEEEEEA
AVAAAGTAGGKGAEEQRDVEAAMAAPVEAEAPPVEAGAAPTEAEFPHVEAGAASMEPTEE
LERILLQLLGDADQENYTYWGQKEEDLRSVETATSYFSGTMNPWSRASPEPLPVQLPASF
TYSYSSPFSSFSGIPTISPPQATVTAPVPTQLPSDWGAFDTSLWSDGGPQRVDPQEHPRD
RRYSEPHQQRRPPVYRRPGDWDCPWCNAVNFSRRDTCFDCGRGIWLQKPH
Download sequence
Identical sequences ENSMMUP00000008793 9544.ENSMMUP00000008793 ENSMMUP00000008793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]