SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008815 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008815
Domain Number 1 Region: 1-159
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 1.83e-29
Family Aldo-keto reductases (NADP) 0.000000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008815   Gene: ENSMMUG00000006891   Transcript: ENSMMUT00000009382
Sequence length 161
Comment pep:novel chromosome:MMUL_1:1:21931789:21962346:-1 gene:ENSMMUG00000006891 transcript:ENSMMUT00000009382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYNATTRQVETELLPCLRHFGLRFYAYNPLAGGLLTGRYKYEDKDRKQPVSRFFGNQWAE
LYRNRYWKENHFEGIALVEKALQAAYGASTPSMTSATLRWMYHHSQLQGAHGDAVILGMS
SLEQLEQNLAAAEEGPLKPAVVDAFNQAWNLVAYECPNYFR
Download sequence
Identical sequences ENSMMUP00000008815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]