SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009012 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009012
Domain Number 1 Region: 59-117
Classification Level Classification E-value
Superfamily Kringle-like 2.43e-19
Family Fibronectin type II module 0.0031
Further Details:      
 
Domain Number 2 Region: 178-223
Classification Level Classification E-value
Superfamily Kringle-like 4.57e-16
Family Fibronectin type II module 0.0022
Further Details:      
 
Domain Number 3 Region: 118-169
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000885
Family Fibronectin type II module 0.0037
Further Details:      
 
Domain Number 4 Region: 27-71
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000542
Family Fibronectin type II module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009012   Gene: ENSMMUG00000006857   Transcript: ENSMMUT00000009590
Sequence length 223
Comment pep:known chromosome:MMUL_1:19:54297885:54310874:1 gene:ENSMMUG00000006857 transcript:ENSMMUT00000009590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRWSSYLLGWATFLLCSYESSGGMHEECVFPFTYKGSVYFTCTKIHSLSPWCATRAVYN
GQWKYCQSEDYPRCIFPFIYRGKAYNSCISQGSFLGSLWCSVTSVFDEKQQWKFCETNEY
GGNSLSKPCIFPSIYRNNVVSDCLEDESNKLWCPTTENMDKDGKWSFCADTRISALVPGF
PCHFPFNYKNKNYFNCTNKGSKENLVWCATSYNYDQDHTWVYC
Download sequence
Identical sequences D1YSI4 G7PY11
ENSMMUP00000009012 ENSMMUP00000009012 NP_001165314.1.72884 XP_005589777.1.63531 9544.ENSMMUP00000009012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]