SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009119 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009119
Domain Number 1 Region: 135-207
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000122
Family Complement control module/SCR domain 0.00034
Further Details:      
 
Domain Number 2 Region: 194-257
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000216
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 451-508
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 346-400
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000027
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 5 Region: 65-131
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000931
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 395-457
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000264
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 282-334
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000472
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009119   Gene: ENSMMUG00000006946   Transcript: ENSMMUT00000009708
Sequence length 590
Comment pep:novel chromosome:MMUL_1:1:163169922:163193211:-1 gene:ENSMMUG00000006946 transcript:ENSMMUT00000009708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRKTLKRHQIMHSQKAPLALLEGSTFDRKGEMAALLFSRLWKVSNSTLFQMMLVTVLLAT
VLGDCGPPPKLPFASPINPLYDTEFKTGTTLKYTCHPGYGKINSSRLICDTKGSWNYSIF
CAKKRCRNPELIIAKCEPPPDIRNGKHSGGDREFYTYASSVTYTCNPYFSLIGNASISCT
VENKTIGVWSPNPPICEKIVCRRPQIPKAIFVSGFGPLYTYKDSIVVNCEEGYSLRGSSL
IYCEANNEWYPSVPSCVSRVDACTDLPDISYASWERNDYNLSDHEIFEIGTELKYLCKPG
YRPVLDEPLTVTCQENLTWTSSNECEIVCCPTPDLENIRIINERRYFTGRCVYAYGDNIS
YMCDEGYYPVSVDGESSCHTDGTWKPKMPACEPVCSYPPSIAHGHYKEVILITSYPEATY
ECDEGYVLAGFATIYCKSFHWQHAPPQCKALCLKPEIVNGRLSVDKDQYVEPENVTIECD
SGYGVIGPKSITCSETRTWYPEVPRCEWEAPEGCEQVLTGRKLMQCLPSPEDVKVALEVY
KLSLEIKQLEKERDKLMNTHQKFSEKEEMKDLFFPSNQHTESSFINSTLP
Download sequence
Identical sequences ENSMMUP00000009119 9544.ENSMMUP00000009119 ENSMMUP00000009119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]