SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009191 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009191
Domain Number 1 Region: 43-86
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000763
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009191   Gene: ENSMMUG00000006996   Transcript: ENSMMUT00000009786
Sequence length 152
Comment pep:known chromosome:MMUL_1:2:86074148:86085137:1 gene:ENSMMUG00000006996 transcript:ENSMMUT00000009786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEPELIELRELAPAGRAGQGRTRLERANALRIARGTACNPARQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCAQQGWFLHRLHQGSAEAGAPCLCALQQEATLLAGCPAG
PRTGHKCQAPHFLLPAQGCCQAPACAVTHKGT
Download sequence
Identical sequences ENSMMUP00000009191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]