SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009200 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009200
Domain Number 1 Region: 139-221
Classification Level Classification E-value
Superfamily Immunoglobulin 2.15e-32
Family C1 set domains (antibody constant domain-like) 0.00014
Further Details:      
 
Domain Number 2 Region: 22-151
Classification Level Classification E-value
Superfamily Immunoglobulin 8.13e-31
Family V set domains (antibody variable domain-like) 0.0000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009200   Gene: ENSMMUG00000015764   Transcript: ENSMMUT00000009795
Sequence length 278
Comment pep:known_by_projection chromosome:MMUL_1:7:85084135:85358305:1 gene:ENSMMUG00000015764 transcript:ENSMMUT00000009795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACPGFLWTLVISTCLESGMAQTVTQSQPEMSVQEAETVTLSCTYDTSDSDYYLFWYKQP
PSRQMILIIRQEAYKQQNATENRFSVNFQKATKSFSLKISDSQLGDAAMYFCAYRSTQQG
GSEKLVFGKGTKLTVNPYIQNPDPAVYQLRGSKSNDTSVCLFTDFDSVMNVSQSKDSDVH
ITDKTVLDMRSMDFKSNGAVAWSNKSDFACTSAFKDSVIPADTFFPGTESVCDANLVEKS
FETDMNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS
Download sequence
Identical sequences ENSMMUP00000020702 ENSMMUP00000009200 9544.ENSMMUP00000009200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]