SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009243 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009243
Domain Number 1 Region: 142-301
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.24e-40
Family Reductases 0.0000337
Further Details:      
 
Domain Number 2 Region: 36-157
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.61e-37
Family Ferredoxin reductase FAD-binding domain-like 0.00000421
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009243   Gene: ENSMMUG00000007047   Transcript: ENSMMUT00000009844
Sequence length 305
Comment pep:known chromosome:MMUL_1:1:167527997:167533383:1 gene:ENSMMUG00000007047 transcript:ENSMMUT00000009844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIQPSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHN
TKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKG
VHPKFPEGGKMSQYLDSLKIGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLG
MIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLW
FTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQK
MRFTY
Download sequence
Identical sequences A0A0D9RP34 A0A1D5R848 A0A2I3M0J6 A0A2K5L579 A0A2K5UAI4 A0A2K5ZBP4 A0A2K6E3K0
ENSMMUP00000009243 ENSMMUP00000009243 ENSPANP00000004130 NP_001244405.1.72884 XP_005540522.1.63531 XP_007987099.1.81039 XP_011744981.1.29376 XP_011845898.1.47321 XP_011893216.1.92194 9544.ENSMMUP00000009243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]