SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009330 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009330
Domain Number 1 Region: 12-38
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000334
Family Ran binding protein zinc finger-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009330   Gene: ENSMMUG00000007128   Transcript: ENSMMUT00000009941
Sequence length 218
Comment pep:known chromosome:MMUL_1:2:63767097:63835821:1 gene:ENSMMUG00000007128 transcript:ENSMMUT00000009941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPKRQAKPAADEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQVAQQY
ATPPPPKKEKKEKVEKQDKEKPEKDKEISPSVTKKNTNKKTKPKSDILKDPPSEANSIQS
ANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSS
AGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF
Download sequence
Identical sequences A0A091DK09 D2GZS5 F7FRK9
ENSCJAP00000027888 ENSMMUP00000009330 ENSCJAP00000027888 ENSTTRP00000005051 9544.ENSMMUP00000009330 9598.ENSPTRP00000026079 9600.ENSPPYP00000015341 9615.ENSCAFP00000009640 ENSMMUP00000009330 ENSTTRP00000005051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]