SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009334 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009334
Domain Number 1 Region: 94-158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0000416
Further Details:      
 
Domain Number 2 Region: 35-88
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000175
Family Complement control module/SCR domain 0.0000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009334   Gene: ENSMMUG00000007129   Transcript: ENSMMUT00000009945
Sequence length 158
Comment pep:known chromosome:MMUL_1:1:162610257:162725844:-1 gene:ENSMMUG00000007129 transcript:ENSMMUT00000009945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPVRLERPFPSRRFPGLLLAALVLRLSSFSDACEAPPTFEAMELIGKPKPYYRVGERV
DYKCKKGYFYIPPLATHTICDRNHTWLPVSDEGCYREMCPHIRDPLNGEAILANGSYEFG
AELHFICNEGYYLIGKDILYCELKDTVAIWSGKPPLCE
Download sequence
Identical sequences ENSMMUP00000009334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]