SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009335 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009335
Domain Number 1 Region: 98-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.28e-16
Family Complement control module/SCR domain 0.0000446
Further Details:      
 
Domain Number 2 Region: 223-287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.56e-16
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 3 Region: 155-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000082
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 4 Region: 35-88
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000931
Family Complement control module/SCR domain 0.0000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009335   Gene: ENSMMUG00000007129   Transcript: ENSMMUT00000009946
Sequence length 399
Comment pep:known chromosome:MMUL_1:1:162582921:162618538:-1 gene:ENSMMUG00000007129 transcript:ENSMMUT00000009946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSGRRERPFSSGRFPGLLLATLVLQLSSFSDACEAPPTFEAMELIGKPKPYYRVGERV
DYKCKKGYFYIPPLATHTICDRNHTWLPVSDEGCYREMCPHIRDPLNGEAILANGSYEFG
AELHFICNEGYYLIGKDILYCELKDTVAIWSGKPPLCEKILCTPPPKIKNGKHTFSEVEV
FEYLDAVTYSCDPAPGPDPFSLIGESMIYCGNNSTWSHAAPECKVVKCRFPVVENGKQIS
GFGKKFYYKATVMFECDKGYYLNGSDKIVCESNSTWDPPVPKCLKVLPPSSTKSPTLSDS
VSTSPTTKSPTSSASGPRPTYKPPVSNYPGYPKPDEGILNNLDDWVIALIVIVIVVAVAV
ICVALYRFLQGRKKKGKADGGPEYATYQMKSTPPAEQRG
Download sequence
Identical sequences F7DTG7
ENSMMUP00000009335 ENSMMUP00000009334 9544.ENSMMUP00000009335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]