SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009337 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009337
Domain Number 1 Region: 223-287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.73e-16
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 2 Region: 98-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5e-16
Family Complement control module/SCR domain 0.0000446
Further Details:      
 
Domain Number 3 Region: 155-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000778
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 4 Region: 35-88
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000877
Family Complement control module/SCR domain 0.0000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009337   Gene: ENSMMUG00000007129   Transcript: ENSMMUT00000009948
Sequence length 384
Comment pep:known chromosome:MMUL_1:1:162582921:162618538:-1 gene:ENSMMUG00000007129 transcript:ENSMMUT00000009948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSGRRERPFSSGRFPGLLLATLVLQLSSFSDACEAPPTFEAMELIGKPKPYYRVGERV
DYKCKKGYFYIPPLATHTICDRNHTWLPVSDEGCYREMCPHIRDPLNGEAILANGSYEFG
AELHFICNEGYYLIGKDILYCELKDTVAIWSGKPPLCEKILCTPPPKIKNGKHTFSEVEV
FEYLDAVTYSCDPAPGPDPFSLIGESMIYCGNNSTWSHAAPECKVVKCRFPVVENGKQIS
GFGKKFYYKATVMFECDKGYYLNGSDKIVCESNSTWDPPVPKCLKVSTSPTTKSPTSSAS
GPRPTYKPPVSNYPGYPKPDEGILNNLDDWVIALIVIVIVVAVAVICVALYRFLQGRKKK
GKADGGPEYATYQMKSTPPAEQRG
Download sequence
Identical sequences H9FUI7
XP_014972361.1.72884 ENSMMUP00000009337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]