SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009366 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009366
Domain Number 1 Region: 88-279
Classification Level Classification E-value
Superfamily Cytochrome c 6.26e-74
Family Cytochrome bc1 domain 0.0000000105
Further Details:      
 
Domain Number 2 Region: 280-325
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.000000000000017
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009366   Gene: ENSMMUG00000007149   Transcript: ENSMMUT00000009980
Sequence length 325
Comment pep:known_by_projection chromosome:MMUL_1:8:146709523:146711992:1 gene:ENSMMUG00000007149 transcript:ENSMMUT00000009980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAVSLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVM
LSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHSGFLSSLDHTSIRRGFQVYKQV
CSSCHSMDFVAYRHLVGVCYTEDEAKALAAEVEVQDGPDENGEMFMRPGKLFDYFPKPYP
NTEAARAANNGALPPDLSYIVLARHGGEDYIFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AISMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPAHDHRKRMGLKMLMMAALLV
PLIFIMKRHKWSVLKSRKLAYRPPK
Download sequence
Identical sequences A0A2K5WMQ0 A0A2K6D0B4 F7DMP6
NP_001180790.1.72884 XP_005564373.1.63531 XP_011750907.1.29376 ENSMMUP00000009366 9544.ENSMMUP00000009366 ENSMMUP00000009366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]