SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009392 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009392
Domain Number 1 Region: 378-642
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.75e-75
Family Eukaryotic proteases 0.0000951
Further Details:      
 
Domain Number 2 Region: 261-375
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-32
Family Kringle modules 0.00033
Further Details:      
 
Domain Number 3 Region: 157-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000205
Family EGF-type module 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000009392
Domain Number - Region: 195-234
Classification Level Classification E-value
Superfamily FnI-like domain 0.00502
Family Fibronectin type I module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009392   Gene: ENSMMUG00000007162   Transcript: ENSMMUT00000010006
Sequence length 651
Comment pep:known_by_projection chromosome:MMUL_1:1:483856:491174:-1 gene:ENSMMUG00000007162 transcript:ENSMMUT00000010006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRWAWVSSPCPSLGLGPFLLLLLLLLPRGSQPQPGGNRTESPEPNATATPAIPTILVTS
ETPATSAPEAEGPQRGGLPPPLRAVPSSSSPQAQALTEDGRPCSHPAHTGPRTQGRGCCL
TVWVSGFQEATRTAGGGHWEEAEPAPHGPSRMSSAALDPCASGPCLNGGSCSNTQDSQSY
HCSCPRAFTGKDCGTEKCFDETRYEYLEGGDRWARVRQGHVEQCECLGGQAQCEGTRHTA
CLSSPCLNGGTCHLIVATGTTVCACLPGFAGRLCNIVPDERCFLGNGTGYRGVASTSTSG
LGCLAWNSDLLYQELHVDSVGTAALLGLGPHAYCRNPDSDERPWCYVVKDSALSWEYCRL
EACESLTRIQLAPDILATLPEPASPGHQSCGRRHKKRTFLRPRIIGGSSSLPGSHPWLAA
IYIGNSFCAGSLVQTCWVVSAAHCFSHSPPRESVSVVLGQHFFNRTTDVTQTFGIEKYIP
YTLYSVFSPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLD
ENVSGYSSSLREALVPLVADHKCSNPDVYGADISPNMLCAGYFDCKSDACQGDSGGPLAC
EKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIRPPRRLVAPS
Download sequence
Identical sequences ENSMMUP00000009392 ENSMMUP00000009392 9544.ENSMMUP00000009392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]