SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009459 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009459
Domain Number 1 Region: 1573-1686
Classification Level Classification E-value
Superfamily C-type lectin-like 1.27e-44
Family Noncollagenous (NC1) domain of collagen IV 0.00000273
Further Details:      
 
Domain Number 2 Region: 1467-1572
Classification Level Classification E-value
Superfamily C-type lectin-like 1.48e-42
Family Noncollagenous (NC1) domain of collagen IV 0.00000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009459   Gene: ENSMMUG00000007205   Transcript: ENSMMUT00000010078
Sequence length 1688
Comment pep:known_by_projection chromosome:MMUL_1:X:106883075:107178184:-1 gene:ENSMMUG00000007205 transcript:ENSMMUT00000010078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLINKLWLLLVTLCLTEELAGAGEKSYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGP
SGPQGFTGSTGLSGLKGERGSPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGP
PGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLD
GITGPQGAPGSSGAVGPAGPPGLQGPPGPPGPPGPDGNMGLGFQGEKGVKGDVGLPGPAG
PPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGIPGLPGPRG
PMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGEKGDIGLPGPDVFIDIDGAVISGNPGD
PGVPGLPGLKGDEGIQGLRGPSGVAGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAA
GLPGRDGLPGPPGPPGPPGPEFEAETLHNKEPGFPGLRGEQGPKGNPGLKGIKGDSGFCA
CDGGVPNTGPPGEPGPPGPRGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGSPGPSGPKG
KKGEPILSTISGMPGDRGDSGSQGFPGVIGKPGNDGVPGLPGLPGLPGDGGQGFPGEKGL
PGLPGEKGHPGPPGLPGIGLPGLPGPRGLPGDKGKDGLPGQQGPPGSKGITLPCIIPGSY
GPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGNKGKPGSPGLVHLPELPGFPGPRGEKGLP
GFPGLPGKDGLPGTIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGDKGLLGDSGLPG
LKGVYGKPGLLGPKGERGSPGTPGPVGQPGTPGSSGPYGIKGKSGLPGAPGFPGTSGHPG
KKGTRGEKGPPGSIVKKGLPGLKGLPGNPGLIGLKGSPGSPGVAGLPALSGPKGEKGSVG
FVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGHAGTPGEKGDRGNPGPVGIPGPRRPMS
NLWLKGDKGSQGSAGSDGFPGPRGDKGEAGQPGPPGLPGAPGLPGTIKGVSGKPGPPGFM
GIRGLPGLKGSSGITGFPGMPGESGSQGIRGSSGLPGTSGLPGLKGDNGQTLEISGSPGP
KGQPGESGFKGTKGRDGPIGNIGFPGNKGEDGKVGVSGDVGLHGAPGFPGVAGMRGEPGL
PGSSGHQGAIGPLGPPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLP
GPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGR
PGLDGERGRPGPPGPPGPTGPSSNQGNTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGL
KGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGPQGAPGQTPTAEAVQVPPGPLG
LPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPG
FEGAPGQQGPFGMPGMPGQSARVGYTLVKHSQSEQVPLCPIGMSQLWVGYSLLFVEGQEK
AHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVSQTQIPQ
YISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGS
CLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSR
CQVCMKSL
Download sequence
Identical sequences F7EQ13
9544.ENSMMUP00000009459 ENSMMUP00000009459 ENSMMUP00000009459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]