SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009478 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009478
Domain Number 1 Region: 389-491
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000009478
Domain Number - Region: 89-164
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0732
Family Myosin rod fragments 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009478   Gene: ENSMMUG00000022044   Transcript: ENSMMUT00000010097
Sequence length 493
Comment pep:known_by_projection chromosome:MMUL_1:8:28021595:28141932:-1 gene:ENSMMUG00000022044 transcript:ENSMMUT00000010097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENKAMYLHTVSDCDTSSICEDSFDGRSLSKLNLCEDGPCHKRRASSCCTQLGSLSALKH
AVLGLYLLVFLILVGIFILAVSRPRSSPDDLKALTRNVNRLNESFRDLQLRLLQAPLQAD
LTEQVWKVQDALQNQSDSLLALAGAVQRLEGALWGLQAQAVQTEQAEAFLMPPETGLRVP
YGILFPLQMTWSCSRRQLPNLSAVFAFPGPPGPKGDQGDEGKEGRPGIPGLPGLRGNGHA
PGRDLRDPQSISTTYFLDGINARAAQGSTQSTPPQTLCSNKRLRGCWCHDGMQHILFLQV
PQSEGKGYSTGPKLPEGVRGVGPCGPVGLCCLPGERGTPGLPGPKGDDGKLGATGPMGMR
GFKGERGPKGEKGEKGDRAGDASGVEAPMMIRLVNGSGPHEGRVEVYHDRRWGTVCDDGW
DKKDGDVVCRMLGFRGVEEVYRTARFGQGTGRIWMDDVACKGTEETIFRCSFSKWGVTNC
GHAEDASVTCNRH
Download sequence
Identical sequences ENSMMUP00000009478 9544.ENSMMUP00000009478 ENSMMUP00000009478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]