SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009654 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009654
Domain Number 1 Region: 1550-1658
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 851-966
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-34
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 3 Region: 204-306
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-33
Family Spermadhesin, CUB domain 0.00069
Further Details:      
 
Domain Number 4 Region: 688-792
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 5 Region: 1831-1940
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 6 Region: 1998-2118
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-31
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 7 Region: 2169-2288
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-31
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 8 Region: 28-134
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-29
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 9 Region: 1370-1486
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-28
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 10 Region: 511-621
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 11 Region: 2357-2461
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.28e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 12 Region: 1030-1139
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 13 Region: 1203-1312
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 14 Region: 3064-3135
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.13e-21
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 15 Region: 2709-2773
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-18
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 16 Region: 2766-2834
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.1e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 17 Region: 2825-2891
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.21e-18
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 18 Region: 3124-3193
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.56e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 19 Region: 2116-2185
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000189
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 20 Region: 2523-2590
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 21 Region: 3183-3239
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 22 Region: 448-519
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000278
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 23 Region: 3244-3312
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000334
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 24 Region: 2880-2941
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000459
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 25 Region: 2650-2713
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000005
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 26 Region: 2461-2534
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 27 Region: 972-1032
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000364
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 28 Region: 1944-2006
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000391
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 29 Region: 1490-1554
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000418
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 30 Region: 2960-3014
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000906
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 31 Region: 1663-1728
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000125
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 32 Region: 626-685
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000136
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 33 Region: 1770-1836
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 34 Region: 1145-1207
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000297
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 35 Region: 140-201
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000499
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 36 Region: 1316-1378
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000129
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 37 Region: 3303-3361
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000195
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 38 Region: 797-865
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000364
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 39 Region: 2595-2657
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000375
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 40 Region: 2287-2350
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000648
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 41 Region: 1724-1763
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000017
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009654   Gene: ENSMMUG00000007342   Transcript: ENSMMUT00000010289
Sequence length 3600
Comment pep:known chromosome:MMUL_1:8:114681032:115918577:-1 gene:ENSMMUG00000007342 transcript:ENSMMUT00000010289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIKSGFTFWNLVFLLTVSCVKGFIYTCGGTLKGLNGTIESPGFPYGYPNGANCTWVIIA
EERNRIQIVFQSFALEEEYDYLSLYDGHPHPTNFRTRLTGFHLPPPVTSTKSVFSLRLTS
DFAVSAHGFKVYYEELQSSSCGNPGVPPKGVLYGTRFDVGDKIRYSCVTGYILDGHPQLT
CIANSVNTASWDFPVPICRAEDACGGTMRGSSGVISSPSFPNEYHNNADCTWTIVAEPGD
TISLIFTDFQMEEKYDYLEIEGSEPPTIWLSGMNIPPPIISNKNWLRLHFVTDSNHRYRG
FSAPYQGSSTLTHTTSTGELEEHNRTTTGALAVASTPADVTVSSVTAVTIHRLSEEQRVQ
VTSLRNSGLDPNTSKDGLSPHQADTQSTRRRPRHAEQIERTKELAVVTHRVKKAIDFKSR
GFKLFPGKDNSNKFSILNEGGIKTASNLCPDPGEPENGKRIGSDFSLGSTVQFSCDEDYV
LQGAKSITCQRIAEVFAAWTDHRPVCKVKTCGSNLQGPSGTFTSPNFPFQYDSNAQCVWV
ITAVNTNKVIQINFEEFDLEIGYDTLTIGDGGEVGDPRTVLQVLTGSFVPDLIVSMSSQM
WLHLQTDESVGSVGFKVNYKEIEKESCGDPGTPLYGIREGDGFSNRDVLRFECQFGFELI
GEKSIVCQENNQWSANIPICIFPCLSNFTAPMGTVLSPDYPEGYGNNLNCIWTIISDPGS
RIHLSFNDFDLESQFDFLAVKDGDSPDSPILGTFTGAEVPSHLTSNSHILRLEFQADHSM
SGRGFNITYNTFGHNECPDPGIPINARRFGDNFQLGSSISVICEEGFIKTQGTETITCIL
MDGKVMWSGPIPKCGAPCGGHFSAPSGVILSPGWPGYYKDSLNCEWVIEAEPGHSIKITF
ERFQTELNYDVLEVHDGPNLLSPLLGSYNGTQVPQFLFSSSNFIYLLFTTDNSRSNNGFK
IHYESVTVNTYSCLDPGIPVHGRRYGHDFSIGSTVSFSCDPGYRLSHEEPLLCEKNHWWS
HPLPTCDALCGGDVRGPSGTILSPGYPEFYPNSLNCTWTVDVTHGKGVQFNFHTFHLEDH
HDYLLITENGSFTQPLARLTGSDLPPTINAGLYGNFRAQLRFISDFSISYEGFNITFSEY
NLEPCEDPGIPQYGSRIGFNFGVGDTLTFSCSSGYRLEGTSEIICLGGGRRVWSAPLPRC
VAECGASATNNEGILLSPNYPLNYENNHECIYSIQVQAGKGINISARTFHLAQGDVLKIY
DGKDKTTHLLGAFTGASMRGLTLSSTSNQLWLEFNSDSEGTDEGFQLVYTSFELSHCEDP
GIPQFGYKISDQGHFAGSTIIYGCNPGYTLHGSSLLKCMTGERRAWDYPLPSCIAECGGR
FKGESSGRILSPGYPFPYDNNLRCMWMIEVDPGNIVSLQFLAFDTEASHDILRVWDGPPE
NEMLLKEISGSLIPEGIHSTLNIVTIQFDTDFYISKSGFAIQFSSSVATACRDPGVPMNG
TRNGDGREPGDTVVFQCDPGYELQGEERITCIQVENRYFWQPSPPVCIAPCGGNLTGSSG
FILSPNFPHPYPHSRDCDWTITVNADYVISLAFISFSIEPNYDFLYIYDGPDSNSPLIGS
FQDSKLPERIESSSNTMHLAFRSDGSVSYTGFHLEYKAKLRESCFDPGNIMNGTRLGMDY
KLGSTVTYYCDAGYVLQGYSTLTCIMGDDGRPGWNRVLPSCHAPCGSRSTGSEGTVLSPN
YPKNYSVGHNCVYSIAVPKEFAVPRTSSTQCSSVPEPRFGRRIGNEFAVGSLVLFECNPG
YILHGSIAIRCETVPNSLAQWNDSLPTCIVPCGGFLTKRKGTILSPGYPEPYDNNLNCVW
KITVPEGAGIQVQVVSFATEHNWDSLDFYDGGDNNAPRLGSYSGTTIPHLLNSTSNNLYL
NFQSDISVSAAGFHLEYTAIGLDSCPEPQTPSSGIKIGDRYMVGDVVSFQCDQGYSLQGH
SHITCMPGPVRRWNYPIPICLAQCGGAMSDFSGVILSPGFPGNYPSSLDCTWTIKLPIGF
GVHLQFVNFSTETIHDYLEVRSGSSETSTVIGRLSGPQIPSSLFSTTHETSLYFHSDYSQ
NKQGFHIVYQAYQLQSCPDPRPFRNGFVIGNDFTVGQTISFECFPGYTLIGNSALTCLHG
VSRNWNHPLPRCEALCGGNITAMNGTIYSPGYPDEYPNFQDCFWLVRVPPGNGIYINFTV
LQTEPIYDFITVWDGPDQNSPQIGQFSGNTALESVYSTSNQILIKFHSDFTTSGFFVLSY
HAYQLRVCQPPPPVPNAEMLTEDDEFEIGDIIRYQCLPGFTLVGNAILTCRLGERLQMDG
APPVCQVLCPANELRLDSTGVILSPGYPDSYPNLQMCAWSISVEKGYNITIFVEFFQTEK
EFDVLQVYDGPNIQSPVLISLSGDYSSAFNITSNGHEVFLQWSADHGNNKKGFRIRYIAF
YCSTPESPPHGYIISQTGGQLNSVVRWACDRGFRLVGKSSAVCRKSSYGYHAWDAPVPAC
QAISCGIPKAPTNGGILTTDYLVGTRVTYFCNDGYRLSSKELTTAVCQSDGTWSNHNKTP
RCVVVTCPSINSFTLEHGRWRIVNGSHYEYKTKVVFSCDPGYHGLGPASIECLPNGTWSW
RNERPYCQIISCGELPTPPNGNKIGTQTSYGSTAIFTCDLGFMLVGSAVRECLSSGLWSG
SETRCLAGHCGTPELIVNGQVIGENYGYRDTVVYQCNPGFRLIGSSVRICQQDHNWSGQL
PSCVPVSCGHPGSPIYGRTSGNGFNFNDVVTFSCNIGYLMQGPTKAQCQANRQWSHPPPV
CKVVNCSDPGIPANSKRESKIEHGNFTYGTVVFYDCNPGYFLFGSSVLICQPNGQWDKPL
PECIMIDCGHPGVPPNAVLSGEKYTFGSTVHYSCTGKRSLLGQSSRTCQLNGHWSGSQPH
CSGTTWKIGQCVLEITLLQESDFRTKSTVRFACDTGYILHGSEERKCLANGSWTGRQPEC
KAVQCGNPGTTANGKVFRIDGTAFPIEILYVSWETASLINLSLKVCLTSKIFSLFSTLPT
TSVISCGDPGIPANGLRYGDDYVVGQNVSYMCQPGYMMELNGSRIRTCTINGTWSGIMPT
CRAVTCPTPPQISNGRLEGTNFDWGFSISYICSPGYELSFPAVLTCVGNGSWSGEVPQCL
PKFCGDPGIPAQGKREGKSFIYQSEVSFSCNSPFILVGSSTRICQADGTWSGSSPHCIEP
TRTSCENPGVPRHGSQNNTFGFQVGSVVQFHCKKGHLLQGSTTRTCLPDLTWSGIQPECI
PHSCKQPETPAHANVVGMDLPSHGYTLIYTCQPGFFLAGGTEHRVCRSDNTWTGKVPVCE
AGSKILVKDPRPALGTPSPKLSVPDDVFAQNYIWKGSYNFKGRKQPMTLTVTSFNASTGR
VNATLSNSNMELLLSGVYKSQEARLMLRIYLIKVPAHASVKKMKEENWAMDGFVSAEPDG
ATYVFQGFIQGKDYGQFGLQRLGLNMSEGLNTSNQPHGTNSSSVAIAILVPFFALIFAGF
GFYLYKQRTAPKTQYTGCSVHENNNGQAAFENPMYDTNTKSVEGKAVRFDPNLNTVCTMV
Download sequence
Identical sequences ENSMMUP00000009654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]