SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009655 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009655
Domain Number 1 Region: 1446-1554
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 747-862
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-34
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 3 Region: 204-306
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-33
Family Spermadhesin, CUB domain 0.00069
Further Details:      
 
Domain Number 4 Region: 584-688
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 5 Region: 1797-1906
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 6 Region: 1964-2084
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-32
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 7 Region: 2135-2254
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-31
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 8 Region: 28-134
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-29
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 9 Region: 1266-1382
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-28
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 10 Region: 407-517
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 11 Region: 2323-2427
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 12 Region: 926-1035
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 13 Region: 1099-1208
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 14 Region: 1614-1729
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-24
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 15 Region: 2965-3036
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.86e-21
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 16 Region: 2610-2678
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.03e-19
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 17 Region: 2667-2735
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.97e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 2726-2792
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.61e-18
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 19 Region: 2489-2562
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.03e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 20 Region: 3025-3094
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.43e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 21 Region: 2082-2151
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000175
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 22 Region: 3084-3140
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000222
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 23 Region: 344-415
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 24 Region: 3145-3213
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000032
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 25 Region: 2781-2842
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000431
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 26 Region: 2427-2500
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 27 Region: 868-928
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000351
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 28 Region: 1910-1972
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000378
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 29 Region: 1386-1450
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000405
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 30 Region: 2546-2607
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000431
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 31 Region: 2861-2915
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000906
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 32 Region: 1559-1624
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000121
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 33 Region: 522-581
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000132
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 34 Region: 1736-1802
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 35 Region: 1041-1103
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000297
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 36 Region: 140-201
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000486
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 37 Region: 1212-1274
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000125
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 38 Region: 3204-3262
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000181
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 39 Region: 693-761
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000351
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 40 Region: 2253-2316
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000634
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009655   Gene: ENSMMUG00000007342   Transcript: ENSMMUT00000010290
Sequence length 3501
Comment pep:known chromosome:MMUL_1:8:114681032:115918577:-1 gene:ENSMMUG00000007342 transcript:ENSMMUT00000010290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIKSGFTFWNLVFLLTVSCVKGFIYTCGGTLKGLNGTIESPGFPYGYPNGANCTWVIIA
EERNRIQIVFQSFALEEEYDYLSLYDGHPHPTNFRTRLTGFHLPPPVTSTKSVFSLRLTS
DFAVSAHGFKVYYEELQSSSCGNPGVPPKGVLYGTRFDVGDKIRYSCVTGYILDGHPQLT
CIANSVNTASWDFPVPICRAEDACGGTMRGSSGVISSPSFPNEYHNNADCTWTIVAEPGD
TISLIFTDFQMEEKYDYLEIEGSEPPTIWLSGMNIPPPIISNKNWLRLHFVTDSNHRYRG
FSAPYQVKKAIDFKSRGFKLFPGKDNSNKFSILNEGGIKTASNLCPDPGEPENGKRIGSD
FSLGSTVQFSCDEDYVLQGAKSITCQRIAEVFAAWTDHRPVCKVKTCGSNLQGPSGTFTS
PNFPFQYDSNAQCVWVITAVNTNKVIQINFEEFDLEIGYDTLTIGDGGEVGDPRTVLQVL
TGSFVPDLIVSMSSQMWLHLQTDESVGSVGFKVNYKEIEKESCGDPGTPLYGIREGDGFS
NRDVLRFECQFGFELIGEKSIVCQENNQWSANIPICIFPCLSNFTAPMGTVLSPDYPEGY
GNNLNCIWTIISDPGSRIHLSFNDFDLESQFDFLAVKDGDSPDSPILGTFTGAEVPSHLT
SNSHILRLEFQADHSMSGRGFNITYNTFGHNECPDPGIPINARRFGDNFQLGSSISVICE
EGFIKTQGTETITCILMDGKVMWSGPIPKCGAPCGGHFSAPSGVILSPGWPGYYKDSLNC
EWVIEAEPGHSIKITFERFQTELNYDVLEVHDGPNLLSPLLGSYNGTQVPQFLFSSSNFI
YLLFTTDNSRSNNGFKIHYESVTVNTYSCLDPGIPVHGRRYGHDFSIGSTVSFSCDPGYR
LSHEEPLLCEKNHWWSHPLPTCDALCGGDVRGPSGTILSPGYPEFYPNSLNCTWTVDVTH
GKGVQFNFHTFHLEDHHDYLLITENGSFTQPLARLTGSDLPPTINAGLYGNFRAQLRFIS
DFSISYEGFNITFSEYNLEPCEDPGIPQYGSRIGFNFGVGDTLTFSCSSGYRLEGTSEII
CLGGGRRVWSAPLPRCVAECGASATNNEGILLSPNYPLNYENNHECIYSIQVQAGKGINI
SARTFHLAQGDVLKIYDGKDKTTHLLGAFTGASMRGLTLSSTSNQLWLEFNSDSEGTDEG
FQLVYTSFELSHCEDPGIPQFGYKISDQGHFAGSTIIYGCNPGYTLHGSSLLKCMTGERR
AWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNNLRCMWMIEVDPGNIVSLQFLAFD
TEASHDILRVWDGPPENEMLLKEISGSLIPEGIHSTLNIVTIQFDTDFYISKSGFAIQFS
SSVATACRDPGVPMNGTRNGDGREPGDTVVFQCDPGYELQGEERITCIQVENRYFWQPSP
PVCIAPCGGNLTGSSGFILSPNFPHPYPHSRDCDWTITVNADYVISLAFISFSIEPNYDF
LYIYDGPDSNSPLIGSFQDSKLPERIESSSNTMHLAFRSDGSVSYTGFHLEYKAKLRESC
FDPGNIMNGTRLGMDYKLGSTVTYYCDAGYVLQGYSTLTCIMGDDGRPGWNRVLPSCHAP
CGSRSTGSEGTVLSPNYPKNYSVGHNCVYSIAVPKEFVVFGQFVFFQTSLHDVVEVYDGP
TQQSSLLSSLSGSHSGESLPLSSGNQITIRFTSVGPITAKGFHFVYQAVPRTSSTQCSSV
PEPRFGRRIGNEFAVGSLVLFECNPGYILHGSIAIRCETVPNSLAQWNDSLPTCIVPCGG
FLTKRKGTILSPGYPEPYDNNLNCVWKITVPEGAGIQVQVVSFATEHNWDSLDFYDGGDN
NAPRLGSYSGTTIPHLLNSTSNNLYLNFQSDISVSAAGFHLEYTAIGLDSCPEPQTPSSG
IKIGDRYMVGDVVSFQCDQGYSLQGHSHITCMPGPVRRWNYPIPICLAQCGGAMSDFSGV
ILSPGFPGNYPSSLDCTWTIKLPIGFGVHLQFVNFSTETIHDYLEVRSGSSETSTVIGRL
SGPQIPSSLFSTTHETSLYFHSDYSQNKQGFHIVYQAYQLQSCPDPRPFRNGFVIGNDFT
VGQTISFECFPGYTLIGNSALTCLHGVSRNWNHPLPRCEALCGGNITAMNGTIYSPGYPD
EYPNFQDCFWLVRVPPGNGIYINFTVLQTEPIYDFITVWDGPDQNSPQIGQFSGNTALES
VYSTSNQILIKFHSDFTTSGFFVLSYHAYQLRVCQPPPPVPNAEMLTEDDEFEIGDIIRY
QCLPGFTLVGNAILTCRLGERLQMDGAPPVCQVLCPANELRLDSTGVILSPGYPDSYPNL
QMCAWSISVEKGYNITIFVEFFQTEKEFDVLQVYDGPNIQSPVLISLSGDYSSAFNITSN
GHEVFLQWSADHGNNKKGFRIRYIAFYCSTPESPPHGYIISQTGGQLNSVVRWACDRGFR
LVGKSSAVCRKSSYGYHAWDAPVPACQAISCGIPKAPTNGGILTTDYLVGTRVTYFCNDG
YRLSSKELTTAVCQSDGTWSNHNKTPRCVVISCGELPTPPNGNKIGTQTSYGSTAIFTCD
LGFMLVGSAVRECLSSGLWSGSETRCLAGHCGTPELIVNGQVIGENYGYRDTVVYQCNPG
FRLIGSSVRICQQDHNWSGQLPSCVPVSCGHPGSPIYGRTSGNGFNFNDVVTFSCNIGYL
MQGPTKAQCQANRQWSHPPPVCKVVNCSDPGIPANSKRESKIEHGNFTYGTVVFYDCNPG
YFLFGSSVLICQPNGQWDKPLPECIMIDCGHPGVPPNAVLSGEKYTFGSTVHYSCTGKRS
LLGQSSRTCQLNGHWSGSQPHCSGTTWKIGQCVLEITLLQESDFRTKSTVRFACDTGYIL
HGSEERKCLANGSWTGRQPECKAVQCGNPGTTANGKVFRIDGTAFPIEILYVSWETASLI
NLSLKVCLTSKIFSLFSTLPTTSVISCGDPGIPANGLRYGDDYVVGQNVSYMCQPGYMME
LNGSRIRTCTINGTWSGIMPTCRAVTCPTPPQISNGRLEGTNFDWGFSISYICSPGYELS
FPAVLTCVGNGSWSGEVPQCLPKFCGDPGIPAQGKREGKSFIYQSEVSFSCNSPFILVGS
STRICQADGTWSGSSPHCIEPTRTSCENPGVPRHGSQNNTFGFQVGSVVQFHCKKGHLLQ
GSTTRTCLPDLTWSGIQPECIPHSCKQPETPAHANVVGMDLPSHGYTLIYTCQPGFFLAG
GTEHRVCRSDNTWTGKVPVCEAGSKILVKDPRPALGTPSPKLSVPDDVFAQNYIWKGSYN
FKGRKQPMTLTVTSFNASTGRVNATLSNSNMELLLSGVYKSQEARLMLRIYLIKVPAHAS
VKKMKEENWAMDGFVSAEPDGATYVFQGFIQGKDYGQFGLQRLGLNMSEGLNTSNQPHGT
NSSSVAIAILVPFFALIFAGFGFYLYKQRTAPKTQYTGCSVHENNNGQAAFENPMYDTNT
KSVEGKAVRFDPNLNTVCTMV
Download sequence
Identical sequences ENSMMUP00000009655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]