SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009684 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009684
Domain Number 1 Region: 351-480
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.14e-40
Family PLC-like (P variant) 0.0014
Further Details:      
 
Domain Number 2 Region: 175-339
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.94e-40
Family Dual specificity phosphatase-like 0.0000105
Further Details:      
 
Domain Number 3 Region: 73-169
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000612
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009684   Gene: ENSMMUG00000007379   Transcript: ENSMMUT00000010322
Sequence length 481
Comment pep:known chromosome:MMUL_1:17:1897782:1974852:1 gene:ENSMMUG00000007379 transcript:ENSMMUT00000010322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SASTQTNEFKGATKETLTIETPHSSECKGAGLLSPVSKSMLERLSKFEVEDAENVASYDT
KIKKIVRSIVSSFAFGIFGVFLVLLDVTLLLADLIFNDSKLYIPLVYRSISLAIALFFLM
DVLLRVFVEGWIHLVRLLRLIILIRIFHLIHQKRELEKLMRRLVSENKRRYTRDGFDLDL
TYVTERIIAMSFPSSGRQSFYRNPIEEVVRFLDKKHPNHYRVYNLCSERAYDPKYFHNRV
SRIMIDDHNVPTLHEMVVFTKEVNEWMAQDPANIVAIHCKGGKGRTGTMICAFLIASEIF
LTAEESLYYFGERRTDKTNSSKFQGVETPSQNRYVGYFAQVKHLYNWNLPPRRILFIKRF
IIYSIRGGVCDLKVRIVMEKKVVFSSTSLGNCSILHDIETDRVLIDVFSGPPLYDDVKVQ
FFSSNLPKYYDNCPFFFWFNTSFIQSNRLYLPRNELDNPHKQKTWKIYPPQFAVEVLFGE
K
Download sequence
Identical sequences ENSMMUP00000009684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]