SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009783 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009783
Domain Number 1 Region: 424-684
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.98e-76
Family Eukaryotic proteases 0.000000009
Further Details:      
 
Domain Number 2 Region: 26-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-30
Family Spermadhesin, CUB domain 0.000000554
Further Details:      
 
Domain Number 3 Region: 184-295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-28
Family Spermadhesin, CUB domain 0.00000172
Further Details:      
 
Domain Number 4 Region: 366-436
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000723
Family Complement control module/SCR domain 0.00000887
Further Details:      
 
Domain Number 5 Region: 300-369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000542
Family Complement control module/SCR domain 0.0000754
Further Details:      
 
Domain Number 6 Region: 135-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000003
Family EGF-type module 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009783   Gene: ENSMMUG00000007459   Transcript: ENSMMUT00000010424
Sequence length 686
Comment pep:known chromosome:MMUL_1:1:14133997:14155135:-1 gene:ENSMMUG00000007459 transcript:ENSMMUT00000010424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLY
FTHFDLELSHLCEYDFVKLSSGAKVLATLCGHESTDTERAPGNDTFYSLGSSLDITFRSD
YSNEKPFTGFEAFYAAEDIDECQVAPGEAPACDHHCHNHLGGFYCSCRVGYILHRNKRTC
SALCSGQVFAQRSGELSSPEYPQPYPKLSSCTYSIRLEEGFSVILDFVESFDVETHPETL
CPYDFLKIQTDSEEHGPFCGKTLPRRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPC
PYPMAPPNGHLSPVQAKYILKDSFSIFCEPGYELLQGHLPLKSFAAVCQKDGSWDQPMPS
CSIVDCGPPDDLPSGRVEYITGPEVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTS
SKGERSPPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGSTAAGALLYDNWVLT
AAHAIYEQKHDASSLDIRLGALKRLSPHYTQAWAEAVFIHEGYTHDAGFDNDIALIKLNN
KVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGLLARNLMYVDIPIVDHQKCTA
AYEKPPYSGGSVTANMLCAGLESGGKDSCRGDSGGALVFLDNETQRWFVGGIVSWGSMNC
GEAGQYGVYTKVINYIPWIKNIISNF
Download sequence
Identical sequences F6SW75
ENSMMUP00000009783 ENSMMUP00000009783 9544.ENSMMUP00000009783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]