SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009852 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009852
Domain Number 1 Region: 10-135
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 2.61e-24
Family Extradiol dioxygenases 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009852   Gene: ENSMMUG00000007505   Transcript: ENSMMUT00000010499
Sequence length 138
Comment pep:known_by_projection chromosome:MMUL_1:X:46630822:46638549:1 gene:ENSMMUG00000007505 transcript:ENSMMUT00000010499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRDSSQTPPPCLIHRLDHIVMTVKSIKDTTKFYSKILGMEVVTFKEDRKALCFGDQKFNL
HEVGKEFEPKAAHPVPGSLDICLITEVPLEEMIQHLKACDVPIEEGPVPRTGAKGPIMSI
YFRDPDRNLIEVSNYISS
Download sequence
Identical sequences ENSMMUP00000009852 ENSMMUP00000009852 9544.ENSMMUP00000009852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]