SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009945 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009945
Domain Number 1 Region: 140-323
Classification Level Classification E-value
Superfamily vWA-like 0.0000000024
Family Integrin A (or I) domain 0.049
Further Details:      
 
Domain Number 2 Region: 628-736
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000738
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009945   Gene: ENSMMUG00000007577   Transcript: ENSMMUT00000010601
Sequence length 1188
Comment pep:known chromosome:MMUL_1:1:67348380:67462333:1 gene:ENSMMUG00000007577 transcript:ENSMMUT00000010601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLAKKIREKFNRYLDVVNRNKQVVEASYTAHLTSPLTAIQDCCTIPPSMMEFDGSFNTNV
SRTISCDRLSTTVNSRAFNPGRDLNSVLADNLKSNPGIKWQYFSSEEGIFTVFPAHKFRC
KGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAAQVILSAIDEHDKISV
LTVADTVRTCSLDQCYKTFLSPATSETKRKMSTFVSNVKSSDSPTQHAVGFQKAFQLIRS
TNNNTKFQANTDMVIIYLSAGITSKDSSEEDKKATLRVINEENSFLNNSVMILTYALMND
GVTGLKELAFLRDLAEQNSGKYGVPDRTALPVIKGSMMVLNQLSNLETTVGRFYTNLPNR
MIDEAVFSLPFSDEMGDGLIMTVSKPCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASY
TFLIDDKGYTLMHPSLTRPYLLSEPPLHTDIIHYENIPKFELVRQNILSLPLGSQIIAVP
VNSSLSWHINKLRETGKEAYNVSYAWKMVQDTSFILCIVVIQPEIPVKQLKNLNTVPSSK
LLYHRLDLLGQPSACLHFKQLATLESPTVMLSAGSFSSPYEHLSQPETKRMVEHYTAYLS
DNTRLIANPGLKFSVRNEVMATSHVTDEWMTQMEMSSLNTYIVRRYIATPNGVLRIYPGS
LMDKAFDPTRRQWYLHAVANPGLISLTGPYLDVGGAGYVVTISHTIHSSSTQLSSGHTVA
VMGIDFTLRYFYKVLMDLLPVCNQDGGNKIRCFIMEDRGYLVAHPTLIDPKGHAPVEQQH
ITHKEPLVANDILNHPNFVKKNLCNSFSDRTVQRFYKFNTSLAGDLTNLVHGSHCSKYRL
ARIPGTNAFVGIVNETCDSLAFCACSMVDRLCLNCHRMEQNECECPCECPLEVNECTGNL
TNAENRNPSCEVHQEPVTYTAIDPGLQDALHQCVNSRCSQRLESGDCFGVLDCEWCMVDS
DGKTHLDKSYCAPQKECFGGIVGAKSPYVDDMGAIGDEVITLNMIKSAPVGPVAGGIMGC
IMVLVLAVYAYRHQIHRRSHQHMSPLAAQEMSVRMSNLENDRDERDDDSHEDRGIISNTR
FIAAVIERHAHSPERRRRYWGRSGTESDHGYSTMSPQEDSENPPCNNDPLSAGVDVGNHD
EDLDLDTPPQTAALLSHKFHHYRSHHPTLHHSHHLQAAVTVHTVDAEC
Download sequence
Identical sequences ENSMMUP00000009945 ENSMMUP00000009945 9544.ENSMMUP00000009945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]