SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009998 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009998
Domain Number 1 Region: 421-681
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-56
Family YWTD domain 0.0000000173
Further Details:      
 
Domain Number 2 Region: 162-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 290-330
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 4 Region: 42-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 5 Region: 256-292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000772
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 6 Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 7 Region: 116-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 8 Region: 202-242
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 332-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 10 Region: 373-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000124
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 11 Region: 692-732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000175
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009998   Gene: ENSMMUG00000007612   Transcript: ENSMMUT00000010656
Sequence length 900
Comment pep:known_by_projection chromosome:MMUL_1:1:56125104:56206389:-1 gene:ENSMMUG00000007612 transcript:ENSMMUT00000010656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPERGALRPLALLLLLLLLQLQHLAAAAADPLLGGQGPAKECEKDQFQCRNERCIPSV
WRCDEDDDCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCT
KQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCVTLCAPHEFQCGNRSCLAAV
FVCDGDDDCGDGSDERGCADPACGPREFRCGRDGGGACIPERWVCDRQFDCEDRSDEAAE
LCGRPGPGATSAPAACATAAQFACRSGECVHLGWRCDGDRDCKDKSDEADCPLGTCHGNE
FQCGDGTCVLAIKRCNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHICTDLKIGFECTCP
AGFQLLDQKTCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDLLTKNCKAAAGKSPS
LIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDKAS
DPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRCTLFSRNLSEPR
AIAVDPLQGFMYWSDWGNQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDS
KLHQLSSIDFSGGNRKMLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEIS
ILAENLNNPHDIVIFHELKQPRAADACKLSVQPNGGCEYLCLPAPQISSHSPKYTCACPD
TMWLGPDMKRCYRAPQSTSTTTLPSTTRTGPASTGAPGTTVHRSTDQNHSTETPNLAAAV
PSSVSVPRAPSISLSTLSPATSNHSQHYGNEDSKMGSTVTAAVIGIIVPIVVIALLCMSG
YLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPARVALSLEDDGLP
Download sequence
Identical sequences XP_001112880.1.72884 ENSMMUP00000009998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]