SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010002 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010002
Domain Number 1 Region: 42-256,296-427
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.47e-52
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010002   Gene: ENSMMUG00000000960   Transcript: ENSMMUT00000010661
Sequence length 468
Comment pep:known_by_projection chromosome:MMUL_1:5:4960315:5004443:-1 gene:ENSMMUG00000000960 transcript:ENSMMUT00000010661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDDHSRFVNCVRFSPD
GNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKI
WDVNVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLRVIKGHS
KSIQCLTVHKNGGKSYIYSGSHDGHINFDSQSWLQRENDSFAGKGHTNQVSRMTVDESGQ
LISCSMDDTVRYTSLTLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKC
FSIDNPGYEPEVVAVHPGGDTVAVGGADGNVRLYSILGTTLKDEGKLLEAKGPVTDVAYS
HDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYV
WTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTITY
Download sequence
Identical sequences ENSMMUP00000010002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]