SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010010 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010010
Domain Number 1 Region: 294-539
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.87e-88
Family Eukaryotic proteases 0.000042
Further Details:      
 
Domain Number 2 Region: 204-300
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-18
Family Hepsin, N-terminal domain 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010010
Domain Number - Region: 183-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000117
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010010   Gene: ENSMMUG00000007618   Transcript: ENSMMUT00000010669
Sequence length 547
Comment pep:known_by_projection chromosome:MMUL_1:14:116292357:116320708:-1 gene:ENSMMUG00000007618 transcript:ENSMMUT00000010669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERDSHGNASPVRTPSAGASPAQASPAGTPPGRASPAQASPAGTPPGRASPAQASPAGTP
PGRASPAQASPARASPAQASPAQAPPVRASPAQVSPVRASPARASPARSSPSRSSSGRSS
SARSASVTTSPTRVYLVRATPVGAVPIRSSPARSAPAARATRESPVQFWRGHTGIRYKEQ
RESCPKHAVRCDGVVDCKLKSDELGCVRFDWDKSLLKIYSGSSHQWLPICSSNWNDSYSE
KTCQQLGFESAYRTTEVAHRDFANSFSISRYNSTIQESLHRSECPSQRYISLQCSHCGLR
AMTGRIVGGALASESKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHCFFVTREKVLEGWK
VYAGTSNLHQLPEAVSIAEIIINSNYTDEEDDYDIALMRLSKPLTLSAHIHHACLPMHGQ
TFSLNETCWITGFGKTRETDDKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGDL
RGGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQRNKPGVYTKVTEVLPWIYSKMES
EVRFGKS
Download sequence
Identical sequences ENSMMUP00000010010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]