SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010061 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010061
Domain Number 1 Region: 7-148
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.83e-25
Family D-ribulose-5-phosphate 3-epimerase 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010061   Gene: ENSMMUG00000007655   Transcript: ENSMMUT00000010724
Sequence length 168
Comment pep:novel chromosome:MMUL_1:2:168497343:168498164:1 gene:ENSMMUG00000007655 transcript:ENSMMUT00000010724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVESLQKQLGQDSFFDMHMRGWVKPMAGAGANQYTFHLEATENSRALIKDIWENELNVGL
AIKLGTTVEYLAPCANKIDMALVMTMEPGFGEQKFMKDMMPKVHWLRTQLLSLDIEDGGV
GPDTVHKGAEGVHMPVSGSAIMRSEDYRYVSTVKNVCMEAAQKCSLSR
Download sequence
Identical sequences ENSMMUP00000010061 9544.ENSMMUP00000010061 ENSMMUP00000010061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]