SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010368 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000010368
Domain Number - Region: 48-104
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 0.0209
Family Molybdopterin synthase subunit MoaE 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010368   Gene: ENSMMUG00000007897   Transcript: ENSMMUT00000011058
Sequence length 184
Comment pep:known chromosome:MMUL_1:1:129581765:129584855:1 gene:ENSMMUG00000007897 transcript:ENSMMUT00000011058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVI
KDLIKVAVKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLL
TECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLD
EGKL
Download sequence
Identical sequences A0A0D9S5V2 A0A2K5JME9 A0A2K5KW37 A0A2K5XBV4 A0A2K6AZ54 A0A2K6JMZ7 A0A2K6NSL0 A9X192 F7AZH6 G8F2C0 H2N5W8 H2PZX9
ENSPPYP00000001024 ENSMMUP00000010368 ENSPTRP00000002170 ENSPTRP00000002170 9544.ENSMMUP00000010368 9598.ENSPTRP00000002170 9600.ENSPPYP00000001024 ENSPPYP00000001024 NP_001244348.1.72884 XP_002810295.1.23681 XP_003308421.1.37143 XP_003817321.1.60992 XP_005541985.1.63531 XP_005541986.1.63531 XP_007975451.1.81039 XP_007975452.1.81039 XP_008968673.1.60992 XP_009429343.1.37143 XP_010385517.1.97406 XP_010385518.1.97406 XP_011767578.1.29376 XP_011767579.1.29376 XP_011767580.1.29376 XP_011793231.1.43180 XP_011828949.1.47321 XP_011924941.1.92194 XP_011924942.1.92194 XP_011924944.1.92194 XP_015006287.1.72884 XP_015313021.1.63531 XP_017733225.1.44346 XP_017733226.1.44346 ENSPANP00000007635 ENSMMUP00000010368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]