SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010395 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010395
Domain Number 1 Region: 26-286
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.57e-81
Family Carbonic anhydrase 0.000000000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010395   Gene: ENSMMUG00000007917   Transcript: ENSMMUT00000011085
Sequence length 315
Comment pep:known_by_projection chromosome:MMUL_1:16:46392320:46402137:-1 gene:ENSMMUG00000007917 transcript:ENSMMUT00000011085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMLLALLALLALSAARPSAAAESHWCYESQANSSKDTCLVPGKWGGNCQKDRQSPINIV
TRKAKMDKKLGRFSFSGYDKKQTWTVQNNGHSVMMLLGNKASISGGGLPARYQATQLHLH
WSNFLDKGSEHSLDGEHFAMEVHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGPQEN
KGFRPLVEALSNIPKPEMNTTMAESSLLDLLPKEEKLRNYFRYLGSLTTPTCDEKVVWTV
FQEPIQLHREQILAFSQKLYYDKDQKLNMTNNIRPLQRPGQRVVLRSGAPGQLLPWVLPA
LLGPTLARLLASFLR
Download sequence
Identical sequences A0A2K5V3L9
XP_001107970.2.72884 XP_005583962.2.63531 9544.ENSMMUP00000010395 ENSMMUP00000010395 ENSMMUP00000010395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]