SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010581 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010581
Domain Number 1 Region: 27-143
Classification Level Classification E-value
Superfamily Immunoglobulin 5.7e-19
Family V set domains (antibody variable domain-like) 0.0055
Further Details:      
 
Domain Number 2 Region: 139-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000258
Family I set domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010581   Gene: ENSMMUG00000008075   Transcript: ENSMMUT00000011292
Sequence length 430
Comment pep:known chromosome:MMUL_1:2:38948127:39126376:-1 gene:ENSMMUG00000008075 transcript:ENSMMUT00000011292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVVKLLLWWNCFSRTSVAASLEVSESPGSIQVARGQTAVLPCTFTTSAALINLNVIWMV
TPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSVFINNTQLSDTGTYQCL
VNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKL
DNTLKLPPTATQDQVQGTVTIRNISTLTSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG
LIAGAVGTGAVIIIFCIALILGAFFYWRSKNKEEEEEEIPNEIREDDLPPKCSSAKAFHT
EISSSDNNTLTSSNTYNSRYWSNNPKVHRNTESVNHFSDLGQSFSLRSGNASIPSIYANG
SHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKPRPPHSHSYTISHATLERIGAVPVMV
PAQSRAGSLV
Download sequence
Identical sequences A0A2K5UN83 A0A2K6CM62
XP_005548140.1.63531 XP_011720518.1.29376 XP_014985397.1.72884 ENSMMUP00000010581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]