SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010672 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010672
Domain Number 1 Region: 33-456
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.06e-117
Family L-arabinose binding protein-like 0.000000000000872
Further Details:      
 
Domain Number 2 Region: 860-1051
Classification Level Classification E-value
Superfamily Nucleotide cyclase 6.12e-67
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000433
Further Details:      
 
Domain Number 3 Region: 554-841
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-52
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010672   Gene: ENSMMUG00000008153   Transcript: ENSMMUT00000011388
Sequence length 1060
Comment pep:known_by_projection chromosome:MMUL_1:1:132190555:132205541:1 gene:ENSMMUG00000008153 transcript:ENSMMUT00000011388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVE
LALARVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAAFLGPGCVY
AAAPVGRFTAHWRVPLLTAGAPALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWER
QALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGR
VIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDV
SARQAFQAAKIITYKEPDNPEYLEFLKQLKHLAREQFNFTMEDGLVNTIPASFHDGLLLY
IQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPETGAF
RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPCGFDNEDPACNQDHLSTLEVLALVGSL
SLLSILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNYG
SLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGA
CTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNL
KSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTLYAKKLWTAPELLRMASPPVRGSQAGD
IYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGLLMQ
RCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLEE
KRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL
NDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRI
RHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETK
AVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGSSTRG
Download sequence
Identical sequences ENSMMUP00000010672 ENSMMUP00000010672 9544.ENSMMUP00000010672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]