SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010680 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010680
Domain Number 1 Region: 12-111
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000127
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 
Domain Number 2 Region: 139-250
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000317
Family V set domains (antibody variable domain-like) 0.016
Further Details:      
 
Domain Number 3 Region: 671-784
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000909
Family V set domains (antibody variable domain-like) 0.01
Further Details:      
 
Domain Number 4 Region: 411-507
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000984
Family I set domains 0.082
Further Details:      
 
Domain Number 5 Region: 810-919
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000442
Family V set domains (antibody variable domain-like) 0.036
Further Details:      
 
Domain Number 6 Region: 545-638
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000118
Family V set domains (antibody variable domain-like) 0.068
Further Details:      
 
Domain Number 7 Region: 281-370
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000242
Family V set domains (antibody variable domain-like) 0.055
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010680
Domain Number - Region: 948-985,1018-1081
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000166
Family C1 set domains (antibody constant domain-like) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010680   Gene: ENSMMUG00000008157   Transcript: ENSMMUT00000011396
Sequence length 1185
Comment pep:known_by_projection chromosome:MMUL_1:1:119549645:119588743:-1 gene:ENSMMUG00000008157 transcript:ENSMMUT00000011396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLVGVVSAQRQVTVQEGPLYRTEGSHITIWCNVSGYQGPSEQNFQWSIYLPSSPEREVQ
IVSTVDSSFPYAIYTQRVRGGKIFIERVQGNSTLLHITDLQARDAGEYECHTPSTDKQYF
GSYSAKMNLVVIPDSLQTTAMPQTLHRVEQDPLELTCEVTSETVQHSHLSVAWLRQKGGE
KPVEVISLSRDFMLHSSSEYAQRQSLGEVRLDKLGRTTFRLTIFHLQPSDQGEFYCEAAE
WIQDPDGSWYAMTRKRSEGAVVNVQPTDKEFTVRLETEKRLHTVGEPVEFRCILEAQNVP
DRYFAVSWAFNSSLIATMGPNAVPVLNSEFAHREARGQLKVAKESDSVFVLKIYHLRQED
SGKYNCRVTEREKTVTGEFIDKESKRPKNIPIIVLPLKSSISVEVASNASVILEGEDLHF
SCSVRTAGRPQGRFSVIWQLVDRQNRRSNIMWLDRDGTVQPGSSYWERSSFGGIQMEQVQ
PNSFSLGIFNSRKEDEGQYECHVTEWVRAVDGEWQIVGERRASTPISITALEMGFAVTAI
SRTPGVTYSDSFDLQCIIKPHYPARVPVSVTWRFQPVGTVEFHDLVTFTRDGGVQWGDRS
SSFRTRTAIEKAESSNNVRLSISRASDTEAGKYQCVAELWRKNYNNTWTRLAERTSNLLE
IRVLQPVTKLQVSKSKRTLTLVENRPIQLNCSVKSQTSQNSHFAVLWYVHKPSDADGKLI
LKTTHNSAFEYGTYAEEEGLRARLQFERHVSGGLFSLTVQRAEVSDSGSYYCHVEEWLLS
PNYAWYKLAEEVSGRTEVTVKQPDSRLRLSQAQGNLSVLETRQVQLECVVLNRTSITSQL
VVEWFVWKPNHPERETVARLSRDATFHYGEQAAKNNLKGRLHLESPSPGVYRLFIQNVAV
QDSGTYSCHVEEWLPSPSGMWYKRAEDTAGQTALTVMRPDASLQVDTVVPNATVSEKAAF
QLDCSIVSRSSQDSRFAVAWYSLRTKAGGKRSSPGLEEQEEERGEEEEEEEEDDDDDPTE
RMALLSVGPDAVFGPEGSPWEGRLRFQRLSPVLYRLTVLQASPRDTGNYSCRVEEWLPSP
QKEWYRLTEEESAPIGIHVLDTSPTLQSIICSNDALFYFVFFYPFPIFGILIITILLVRF
KSRNSSKNSDGKNGVPLLWIKEPHLNYSPTCLEPPVLSIHPGAID
Download sequence
Identical sequences ENSMMUP00000010680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]