SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010726 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010726
Domain Number 1 Region: 323-618
Classification Level Classification E-value
Superfamily Kelch motif 3.01e-74
Family Kelch motif 0.0000892
Further Details:      
 
Domain Number 2 Region: 8-62,118-182
Classification Level Classification E-value
Superfamily POZ domain 1.49e-28
Family BTB/POZ domain 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010726
Domain Number - Region: 79-104
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0497
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010726   Gene: ENSMMUG00000008190   Transcript: ENSMMUT00000011444
Sequence length 630
Comment pep:known_by_projection chromosome:MMUL_1:18:25639277:25737459:-1 gene:ENSMMUG00000008190 transcript:ENSMMUT00000011444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAVLASCSQYFRS
LFSSHPPLGGGVGGQDGLGAPKDQQQPPQQQQPSQQQQPPPQEEPGTPSSSPDDKLLTSP
RAINNLVLQGCSSIGLRLVLEYLYTANVTLSLDTVEEVLSVSKILHIPQVTKLCVQFLND
QISVQNYKQVCKIAALHGLEETKKLANKYLVEDVLLLNFEEMRALLDSLPPPVESELALF
QMSVLWLEHDRETRMQYAPDLMKRLRFALIPAPELVERVQSVDFMRTDPVCQKLLLDAMN
YHLMPFRQHCRQSLASRIRSNKKMLLLVGGLPPGPDRLPSNLVQYYDDEKKTWKILTIMP
YNSAHHCVVEVENFLFVLGGEDQWNPNGKHSTNFVSRYDPRFNSWIQLPPMQERRASFYA
CRLDKHLYVIGGRNETGYLSSVECYNLETNEWRYVSSLPQPLAAHAGAVHNGKIYISGKG
VHNGEYVPWLYCYDPVMDVWARKQDMNTKRAIHTLAVMNDRLYAIGGNHLKGFSHLDVML
VECYDPKGDQWNILQTPILEGRSGPGCAVLDDSIYLVGGYSWSMGAYKSSTICYCPEKGT
WTELEGDVAEPLAGPACVTVILPSCVPYNK
Download sequence
Identical sequences 9544.ENSMMUP00000010726 ENSMMUP00000010726 ENSMMUP00000010726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]