SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010747 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010747
Domain Number 1 Region: 260-436
Classification Level Classification E-value
Superfamily ITPase-like 2.01e-30
Family YjjX-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010747   Gene: ENSMMUG00000008202   Transcript: ENSMMUT00000011465
Sequence length 464
Comment pep:known_by_projection chromosome:MMUL_1:6:123915312:123941242:1 gene:ENSMMUG00000008202 transcript:ENSMMUT00000011465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEESGIETTPPGTPPPNPAGLAATAMSSTPVPLAATSSFSSPNVSSMESFPPLAYSTPQ
PPLPPMRPSAPLPFVPPPAVPSVPPLVTSMPPPVSPSSAAAFGNPPISHFPPSTSAPNAL
SPAPPSGPPISGFSVGSTYDITRGHAGRAXXXXXXXXXXXXXTLHCLLPAPITQQASLTP
LAQGTGTTSAITFPEEQEDPRINRGQDEASAGGIWGFIKGVAGNPMVKSVLDKTKHSVES
MITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVVGEAGQSNIAPQP
VGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVHGIH
LETFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLNVSRTDWHMAFTGM
SRRQMIYSAARAIAGIAVAELFHGLIEARFPARGGLVGLLLGTV
Download sequence
Identical sequences 9544.ENSMMUP00000010747 ENSMMUP00000010747 ENSMMUP00000010747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]