SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010760 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010760
Domain Number 1 Region: 116-178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000057
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 263-323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000292
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 78-126
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000292
Family Complement control module/SCR domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010760   Gene: ENSMMUG00000008210   Transcript: ENSMMUT00000011478
Sequence length 464
Comment pep:known_by_projection chromosome:MMUL_1:X:99330119:99354915:1 gene:ENSMMUG00000008210 transcript:ENSMMUT00000011478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQLTQRGALSLLFFLTPAVTPTWYAGSGYYPDESYNEVYAEEVPRAPALDYRVPRWCY
TLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQM
RCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDID
PPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIR
YTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQG
TPSRVCQSSRQWSGSPPICTPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQ
ISMLQRCSLQHKPYLLPETFCNKPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLI
DKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE
Download sequence
Identical sequences 9544.ENSMMUP00000010760 ENSMMUP00000010760 ENSMMUP00000010760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]