SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010784 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010784
Domain Number 1 Region: 6-122
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.52e-45
Family MHC antigen-recognition domain 0.00000566
Further Details:      
 
Domain Number 2 Region: 122-218
Classification Level Classification E-value
Superfamily Immunoglobulin 6.7e-27
Family C1 set domains (antibody constant domain-like) 0.0000093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010784   Gene: ENSMMUG00000029799   Transcript: ENSMMUT00000011502
Sequence length 266
Comment pep:known chromosome:MMUL_1:4:32150095:32158390:-1 gene:ENSMMUG00000029799 transcript:ENSMMUT00000011502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPCFLEQFKSDCHFFNGTERVRFLERYL
YNQEEYVRFDSDVGEHRAVSELGRPDAEYWNSQKDILEDQRASVDTFCRHNYRVAESFTV
QRRVQPKVTVYPSKTQPLQHHTLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPQSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGLLS
Download sequence
Identical sequences ENSMMUP00000010784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]