SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010789 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000010789
Domain Number - Region: 5-61
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0968
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010789   Gene: ENSMMUG00000008233   Transcript: ENSMMUT00000011507
Sequence length 170
Comment pep:known chromosome:MMUL_1:15:77324919:77329163:-1 gene:ENSMMUG00000008233 transcript:ENSMMUT00000011507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNRTSLVLCALALLMGFLMVCLGAFFISWDSIFNCQGSLIAAYLLLPLGFVILLSGIFW
SNYRQVTERKGVLRHVLGQHLAHGALPLATVDRPDFYPPAYEESLEVEKQNCPAEREASG
IPPPLYTETGLEFQDGNDSHPEAPPSYRESIAGLVVTATLEDAQRQGQEC
Download sequence
Identical sequences A0A2K6CA39 F7HSF9 G7PSH3
9544.ENSMMUP00000010789 ENSMMUP00000010789 ENSMMUP00000010789 NP_001180895.1.72884 XP_005581925.1.63531 XP_011756752.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]