SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010806 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010806
Domain Number 1 Region: 32-192
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.45e-53
Family Aldose 1-epimerase (mutarotase) 0.0000000416
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010806   Gene: ENSMMUG00000008248   Transcript: ENSMMUT00000011527
Sequence length 200
Comment pep:known chromosome:MMUL_1:13:38644017:38662806:1 gene:ENSMMUG00000008248 transcript:ENSMMUT00000011527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAGITGIVGSSCTRRTFPMASVTRAAFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITA
LEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKE
PNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELVVNYR
AQASQATPVNLTILTSTWQA
Download sequence
Identical sequences ENSMMUP00000010806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]